Signal Peptide Peptidase Recombinant Protein Antigen

Images

 
There are currently no images for Signal Peptide Peptidase Recombinant Protein Antigen (NBP2-54935PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Signal Peptide Peptidase Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Signal Peptide Peptidase.

Source: E. coli

Amino Acid Sequence: KGEVTEMFSYEESNPKDPAAVTESKEGTEASASKGLEKKEK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
HM13
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-54935.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking tide related information and a protocol, click here.

Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Signal Peptide Peptidase Recombinant Protein Antigen

  • dJ324O17.1
  • EC 3.4.23.-
  • H13hIMP1
  • histocompatibility (minor) 13
  • IMP-1
  • IMP1MSTP086
  • Intramembrane protease 1
  • minor histocompatibility antigen 13
  • minor histocompatibility antigen H13
  • Presenilin-like protein 3
  • PSENL3
  • PSL3IMPAS
  • signal peptide peptidase beta
  • Signal peptide peptidase
  • SPPIMPAS-1

Background

Signal Peptide Peptidase is encoded by this gene, which localizes to the endoplasmic reticulum, catalyzes intramembrane proteolysis of some signal peptides after they have been cleaved from a preprotein. This activity is required to generate signal sequence-derived human lymphocyte antigen-E epitopes that are recognized by the immune system, and to process hepatitis C virus core protein. The encoded protein is an integral membrane protein with sequence motifs characteristic of the presenilin-type aspartic proteases. Multiple transcript variants encoding several different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-38956
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
664-LI
Species: Hu
Applications: BA
NBP2-02627
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-91705
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-86616
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-58917
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-83107
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
292-G2
Species: Hu
Applications: BA
AF2307
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), WB
NB100-74510
Species: Hu, Mu, Pm, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
MAB7089
Species: Mu
Applications: CyTOF-ready, Flow, IHC
NBP1-87512
Species: Hu
Applications: IHC, IHC-P
NBP2-38877
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
NBP1-84339
Species: Hu
Applications: IHC, IHC-P, WB
NB100-74513
Species: Hu, Mu, Pm, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
H00121665-Q01
Species: Hu
Applications: ELISA, AP, PA, WB
MAB4077
Species: Hu
Applications: IHC, WB

Publications for Signal Peptide Peptidase Recombinant Protein Antigen (NBP2-54935PEP) (0)

There are no publications for Signal Peptide Peptidase Recombinant Protein Antigen (NBP2-54935PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Signal Peptide Peptidase Recombinant Protein Antigen (NBP2-54935PEP) (0)

There are no reviews for Signal Peptide Peptidase Recombinant Protein Antigen (NBP2-54935PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Signal Peptide Peptidase Recombinant Protein Antigen (NBP2-54935PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Signal Peptide Peptidase Products

Bioinformatics Tool for Signal Peptide Peptidase Recombinant Protein Antigen (NBP2-54935PEP)

Discover related pathways, diseases and genes to Signal Peptide Peptidase Recombinant Protein Antigen (NBP2-54935PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Signal Peptide Peptidase Recombinant Protein Antigen (NBP2-54935PEP)

Discover more about diseases related to Signal Peptide Peptidase Recombinant Protein Antigen (NBP2-54935PEP).
 

Pathways for Signal Peptide Peptidase Recombinant Protein Antigen (NBP2-54935PEP)

View related products by pathway.

Blogs on Signal Peptide Peptidase

There are no specific blogs for Signal Peptide Peptidase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Signal Peptide Peptidase Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol HM13