Sigma-1 R/OPRS1 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

Sigma-1 R/OPRS1 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SIGMAR1.
  
  

  Source: E. coli

  Amino Acid Sequence: HSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTY

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: SIGMAR1
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-82480.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 29 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Sigma-1 R/OPRS1 Recombinant Protein Antigen

• Aging-associated gene 8 protein
• ALS16
• FLJ25585
• hSigmaR1
• OPRS1
• SIG-1R
• sigma 1
• Sigma 1-type opioid receptor
• sigma non-opioid intracellular receptor 1
• Sigma-1 R
• sigma1 receptor
• Sigma1R
• Sigma-1R
• sigma1-receptor
• SIGMAR1
• SR31747 binding protein 1
• SR31747-binding protein
• SRBP
• SR-BP
• SR-BP1
• SRBPMGC3851
• type I sigma receptor

Background

OPRS1 encodes a receptor protein that interacts with a variety of psychotomimetic drugs, including cocaine and amphetamines. The receptor is believed to play an important role in the cellular functions of various tissues associated with the endocrine, immune, and nervous systems. As indicated by its previous name, opioid receptor sigma 1 (OPRS1), the product of this gene was erroneously thought to function as an opioid receptor; it is now thought to be a non-opioid receptor. Alternative splicing of this gene results in transcript variants encoding distinct isoforms. [provided by RefSeq]. Transcript Variant: This variant (1) encodes the longest isoform (1). Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Publications for Sigma-1 R/OPRS1 Protein (NBP1-82480PEP)(1)

Publication using NBP1-82480PEP

• Choi HS, Lee MJ, Choi SR et al. Spinal Sigma-1 receptor-mediated dephosphorylation of astrocytic aromatase plays a key role in formalin-induced inflammatory nociception. Neuroscience 2017-12-28 [PMID: 29289721] (Human)

Bioinformatics

• Gene Symbol: SIGMAR1