Siglec-9 Antibody

Images

 
Western Blot: Siglec-9 Antibody [NBP1-85755] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more
Immunohistochemistry-Paraffin: Siglec-9 Antibody [NBP1-85755] - Staining of human spleen shows strong cytoplasmic positivity in cells in red pulp.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Siglec-9 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:QNLTMTVFQGDGTVSTVLGNGSSLSLPEGQSLRLVCAVDAVDSNPPARLSLSWRGLTLCPSQPSNPGVLELPWVHLRDEAEFTCRAQNPLGSQQVYLNVSLQSKATSGVTQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SIGLEC9
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Siglec-9 Recombinant Protein Antigen (NBP1-85755PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Siglec-9 Antibody

  • CD329
  • CDw329
  • FOAP-9
  • OBBP-Like
  • Protein FOAP-9
  • sialic acid binding Ig-like lectin 9
  • sialic acid-binding Ig-like lectin 9
  • Siglec9
  • Siglec-9

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
AF1138
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
NBP2-22377
Species: Hu
Applications: WB, IHC, IHC-P
AF1072
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
MAB7975
Species: Hu
Applications: Flow, CyTOF-ready
NBP1-83276
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB120-13550
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-1468
Species: Hu
Applications: WB, IHC-P, S-ELISA
NBP2-46125
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, IF
AF2130
Species: Hu
Applications: WB, Flow, Block, CyTOF-ready
NB110-60490
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-84590
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Siglec-9 Antibody (NBP1-85755) (0)

There are no publications for Siglec-9 Antibody (NBP1-85755).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Siglec-9 Antibody (NBP1-85755) (0)

There are no reviews for Siglec-9 Antibody (NBP1-85755). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Siglec-9 Antibody (NBP1-85755) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Siglec-9 Products

Bioinformatics Tool for Siglec-9 Antibody (NBP1-85755)

Discover related pathways, diseases and genes to Siglec-9 Antibody (NBP1-85755). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Siglec-9 Antibody (NBP1-85755)

Discover more about diseases related to Siglec-9 Antibody (NBP1-85755).
 

Pathways for Siglec-9 Antibody (NBP1-85755)

View related products by pathway.

PTMs for Siglec-9 Antibody (NBP1-85755)

Learn more about PTMs related to Siglec-9 Antibody (NBP1-85755).

Blogs on Siglec-9

There are no specific blogs for Siglec-9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Siglec-9 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SIGLEC9
Entrez