Siglec-5/CD170 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: KARRKQAAGRPEKMDDEDPIMGTITSGSRKKPWPDSAGDQASPPGDAPPLEEQKELHYASLSFSEMKSREPKDQEAPSTTEYSEIKTSK |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
SIGLEC5 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:20 - 1:50
- Immunohistochemistry-Paraffin 1:20 - 1:50
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
| Publications |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Siglec-5/CD170 Antibody - BSA Free
Background
SIGLEC5 - sialic acid binding Ig-like lectin 5
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Po, V-Vi
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, In vivo, RIA, WB
Species: Mu
Applications: Neut
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut, WB
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, Neut, WB
Species: Hu
Applications: BA
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, WB
Species: Mu
Applications: Neut
Species: Hu
Applications: Block, CyTOF-ready, Flow, WB
Species: Rt
Applications: BA
Species: Hu
Applications: CyTOF-ready, Flow
Species: Hu
Applications: CyTOF-reported, Flow, ICC, IHC, Neut
Species: Hu
Applications: Flow, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: IHC
Publications for Siglec-5/CD170 Antibody (NBP1-91149)(1)
Showing Publication 1 -
1 of 1.
| Publication using NBP1-91149 |
Applications |
Species |
| Yexian Yuan, Ruoci Hu, Jooman Park, Shaolei Xiong, Zilai Wang, Yanyu Qian, Zuoxiao Shi, Ruifan Wu, Zhenbo Han, Sang-Ging Ong, Shuhao Lin, Krista A. Varady, Pingwen Xu, Daniel C. Berry, Gang Shu, Yuwei Jiang Macrophage-derived chemokine CCL22 establishes local LN-mediated adaptive thermogenesis and energy expenditure Science Advances 2024-06-28 [PMID: 38924414] |
|
|
Reviews for Siglec-5/CD170 Antibody (NBP1-91149) (0)
There are no reviews for Siglec-5/CD170 Antibody (NBP1-91149).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for Siglec-5/CD170 Antibody (NBP1-91149) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Siglec-5/CD170 Products
Research Areas for Siglec-5/CD170 Antibody (NBP1-91149)
Find related products by research area.
|
Blogs on Siglec-5/CD170