Siglec-5/CD170 Antibody - BSA Free

Immunohistochemistry-Paraffin: Siglec-5/CD170 Antibody [NBP1-91149] - Staining of human stomach shows no cytoplasmic positivity in glandular cells as expected.

Immunohistochemistry-Paraffin: Siglec-5/CD170 Antibody [NBP1-91149] - Staining of human bone marrow shows strong cytoplasm granular positivity in hematopoietic cells.

Immunohistochemistry-Paraffin: Siglec-5/CD170 Antibody [NBP1-91149] - Staining of human smooth muscle shows weak cytoplasmic positivity in smooth muscle cells.

Immunohistochemistry-Paraffin: Siglec-5/CD170 Antibody [NBP1-91149] - Staining of human tonsil shows moderate cytoplasm granular positivity in non-germinal center cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Siglec-5/CD170 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KARRKQAAGRPEKMDDEDPIMGTITSGSRKKPWPDSAGDQASPPGDAPPLEEQKELHYASLSFSEMKSREPKDQEAPSTTEYSEIKTSK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SIGLEC5
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Siglec-5/CD170 Protein (NBP1-91149PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Siglec-5/CD170 Antibody - BSA Free

• CD170 antigen
• CD170
• CD33 antigen-like 2
• CD33L2
• CD33L2OB binding protein-2
• OBBP2
• OB-BP2OB-binding protein 2
• OBBP2sialic acid-binding Ig-like lectin 5
• Obesity-binding protein 2
• sialic acid binding Ig-like lectin 5
• sialic acid-binding immunoglobulin-like lectin 5
• Siglec5
• Siglec-5

Background

SIGLEC5 - sialic acid binding Ig-like lectin 5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Siglec-5/CD170 Antibody (NBP1-91149)(1)

Publication using NBP1-91149

• Yexian Yuan, Ruoci Hu, Jooman Park, Shaolei Xiong, Zilai Wang, Yanyu Qian, Zuoxiao Shi, Ruifan Wu, Zhenbo Han, Sang-Ging Ong, Shuhao Lin, Krista A. Varady, Pingwen Xu, Daniel C. Berry, Gang Shu, Yuwei Jiang Macrophage-derived chemokine CCL22 establishes local LN-mediated adaptive thermogenesis and energy expenditure Science Advances 2024-06-28 [PMID: 38924414]

Bioinformatics

• Gene Symbol: SIGLEC5