Siglec-2/CD22 Antibody - BSA Free

Staining of human tonsil shows moderate to strong cytoplasmic positivity in germinal center cells and non-germinal center cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Siglec-2/CD22 Antibody - BSA Free Summary

• Immunogen: This antibody has been engineered to specifically recognize the recombinant protein Siglec-2/CD22 using the following amino acid sequence: SVTRYEWKPHGAWEEPSLGVLKIQNVGWDNTTIACAACNSWCSWASPVALNVQYAPRDVRVRKIKPLSEIHSGNSVSLQCDFSSSHPKE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CD22
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, we recommend using Heat-Induced Epitope Retrieval (HIER) with a pH level of 6. This optimized retrieval method ensures the best results for your experiments.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, pH 7.2, 40% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Siglec-2/CD22 Antibody - BSA Free

• B-cell receptor CD22
• BL-CAM
• B-lymphocyte cell adhesion molecule
• CD22 antigenMGC130020
• CD22 molecule
• CD22
• sialic acid binding Ig-like lectin 2
• Sialic acid-binding Ig-like lectin 2
• Siglec2
• Siglec-2
• SIGLEC2FLJ22814
• T-cell surface antigen Leu-14

Background

CD22 is a single-pass type 1 membrane glycoprotein found in the cytoplasm and cell membrane of B-lymphocytes. CD22 has at least two isoforms (alpha and beta) produced by alternate splicing. The protein exists predominantly as a monomer of the beta isoform (95 kDa). It is also found as a heterodimer of the beta and alpha isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

FAQs for Siglec-2/CD22 Antibody (NBP3-25138). (Showing 1 - 1 of 1 FAQ).

1. I am interested in buying a CD22 antibody for fluorescence microscopy and FACS I red on your web page that you also offer to label your antibodies, if required, is that correct?
   • We do have the ability to perform custom conjugations on certain antibodies, including some to the CD22 protein. If you send me the conjugate you are interested in I can provide you with a quote.

Bioinformatics

• Gene Symbol: CD22