Siglec-11 Antibody

Images

 
Immunohistochemistry-Paraffin: Siglec-11 Antibody [NBP2-32523] - Staining of human placenta shows strong cytoplasmic positivity in Hofbauer cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Siglec-11 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: YSEIKIHTGQPLRGPGFGLQLEREMSGMVPK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SIGLEC11
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Siglec-11 Protein (NBP2-32523PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Siglec-11 Antibody

  • sialic acid binding Ig-like lectin 11
  • sialic acid-binding Ig-like lectin 11
  • Sialic acid-binding lectin 11
  • Siglec11
  • Siglec-11

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22377
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-83276
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
MAB5240
Species: Hu
Applications: WB, CyTOF-ready, ICFlow
NBP2-02710
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF4036
Species: Hu
Applications: WB, Simple Western
H00005324-M02
Species: Hu
Applications: WB, ELISA, IHC
NBP1-32920
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-22439
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF2034
Species: Hu
Applications: WB, IHC
NBP2-54602
Species: Vi
Applications: WB, ELISA, Flow, ICC/IF
NBP2-02149
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-88956
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34390
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP

Publications for Siglec-11 Antibody (NBP2-32523) (0)

There are no publications for Siglec-11 Antibody (NBP2-32523).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Siglec-11 Antibody (NBP2-32523) (0)

There are no reviews for Siglec-11 Antibody (NBP2-32523). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Siglec-11 Antibody (NBP2-32523) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Siglec-11 Products

Bioinformatics Tool for Siglec-11 Antibody (NBP2-32523)

Discover related pathways, diseases and genes to Siglec-11 Antibody (NBP2-32523). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Siglec-11 Antibody (NBP2-32523)

Discover more about diseases related to Siglec-11 Antibody (NBP2-32523).
 

Pathways for Siglec-11 Antibody (NBP2-32523)

View related products by pathway.

PTMs for Siglec-11 Antibody (NBP2-32523)

Learn more about PTMs related to Siglec-11 Antibody (NBP2-32523).

Blogs on Siglec-11

There are no specific blogs for Siglec-11, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Siglec-11 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SIGLEC11
Entrez