Siglec-11 Antibody - BSA Free

Immunohistochemistry-Paraffin: Siglec-11 Antibody [NBP2-32523] - Staining of human placenta shows strong cytoplasmic positivity in Hofbauer cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Siglec-11 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: YSEIKIHTGQPLRGPGFGLQLEREMSGMVPK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SIGLEC11
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Siglec-11 Protein (NBP2-32523PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Siglec-11 Antibody - BSA Free

• sialic acid binding Ig-like lectin 11
• sialic acid-binding Ig-like lectin 11
• Sialic acid-binding lectin 11
• Siglec11
• Siglec-11

Background

SIGLECs are a family of cell surface lectins defined by shared structural motifs in the first 2 immunoglobulin(Ig)-like domains and by their ability to recognize sialic acids via the first Ig V set domain.(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SIGLEC11