SIAH2 Antibody - BSA Free

Western Blot: SIAH2 Antibody [NBP2-85729] - WB Suggested Anti-SIAH2 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:62500. Positive Control: Human Muscle

Western Blot: SIAH2 Antibody [NBP2-85729] - Host: Rabbit. Target Name: SIAH2. Sample Type: 721_B. Antibody Dilution: 1.0ug/mlSIAH2 is supported by BioGPS gene expression data to be expressed in 721_B

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

SIAH2 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SIAH2. Peptide sequence: AVDWVMMQSCFGHHFMLVLEKQEKYEGHQQFFAIVLLIGTRKQAENFAYR The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SIAH2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for SIAH2 Antibody - BSA Free

• E3 ubiquitin-protein ligase SIAH2
• EC 6.3.2
• EC 6.3.2.-
• hSiah2
• seven in absentia (Drosophila) homolog 2
• seven in absentia homolog 2 (Drosophila)
• Seven in absentia homolog 2
• siah-2

Background

The Drosophila SINA (seven in absentia) protein is an E3 ubiquitin ligase component of the RAS signal transduction pathway. The RAS signal pathway controls cell proliferation, differentiation, and survival, and regulation of this pathway is critical for normal development. In Drosophila, SINA serves as a downstream gatekeeper required for proper RAS signal transduction. Similarly to SINA in Drosophila, the human protein SIAH has also been shown to be required for oncogenic RAS signaling in cancer.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SIAH2