SHQ1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SHQ1 Antibody [NBP1-92388] - Staining of human cell line A-431 shows localization to nucleoplasm. Antibody staining is shown in green.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SHQ1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ELKDSPSETVSSLQGPFLEESSAFLIVDGGVRRNTAIQESDASQGKPLASSWPLGVSGPLIEELGEQLKTTVQVSEPKGTTAVNRSNIQERDGCQTPNN
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SHQ1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04 - 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. For ICC/IF fixation/permeabilization, use PFA/Triton X-100. Use in WB reported in secitific publication PMID: 32522979
Control Peptide
SHQ1 Protein (NBP1-92388PEP)
Publications
Read Publication using
NBP1-92388 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SHQ1 Antibody

  • DKFZp686H07226
  • FLJ10539
  • protein SHQ1 homolog
  • SHQ1 homolog (S. cerevisiae)
  • Shq1p

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85156
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-57138
Species: Hu
Applications: WB
NBP1-77306
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
NBP1-83837
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89306
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, KD
NBP1-77685
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-13656
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00006449-M06
Species: Hu
Applications: WB, ELISA, ICC/IF, IP, S-ELISA
NBP2-01764
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-86088
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81388
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-33278
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85872
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20245
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, KD
NBP2-31742
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00010910-M04
Species: Hu, Mu, Rt
Applications: WB, ELISA, IP
NBP1-92388
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for SHQ1 Antibody (NBP1-92388)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for SHQ1 Antibody (NBP1-92388) (0)

There are no reviews for SHQ1 Antibody (NBP1-92388). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SHQ1 Antibody (NBP1-92388) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SHQ1 Products

Bioinformatics Tool for SHQ1 Antibody (NBP1-92388)

Discover related pathways, diseases and genes to SHQ1 Antibody (NBP1-92388). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SHQ1 Antibody (NBP1-92388)

Discover more about diseases related to SHQ1 Antibody (NBP1-92388).
 

Pathways for SHQ1 Antibody (NBP1-92388)

View related products by pathway.

PTMs for SHQ1 Antibody (NBP1-92388)

Learn more about PTMs related to SHQ1 Antibody (NBP1-92388).

Blogs on SHQ1

There are no specific blogs for SHQ1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SHQ1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SHQ1
Entrez
Uniprot