Home » SHISA5 » SHISA5 Proteins » SHISA5 Recombinant Protein Antigen

SHISA5 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for SHISA5 Protein (NBP1-83190PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

SHISA5 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SHISA5.

Source: E.coli

Amino Acid Sequence: EVCMASRGLSLFPESCPDFCCGTCDDQYCCSDVLKKFVWSEERCAVPEASVPASVEPVEQLGSALRFRPGYNDPMS
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SHISA5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-83190.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for SHISA5 Recombinant Protein Antigen

  • protein shisa-5
  • Putative NF-kappa-B-activating protein 120
  • Scotin
  • SCOTINhShisa5
  • shisa homolog 5 (Xenopus laevis)

Background

SHISA5 is a gene that codes for a protein with four isoforms with lengths of 240, 209, 137, and 118 amino acids and weights of approximately 26, 22, 15, and 13 kDa respectively. The protein that SHISA5 codes for is able to induce apoptosis in both caspase-dependent and p53/TP53-dependent apoptosis. Current research is being done on diseases and disorders related to this gene including carcinoma, pandas, neuroblastoma, and schizophrenia. SHISA5 has also been shown to have interactions with COPS5, TP53, WWOX, and ALG2 in pathways such as the p53 signaling pathway.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

p53 Antibody (PAb
240) - BSA Free
NB200-103
Flow Cytometry: p53 Antibody (PAb 240) [NB200-103] - An intracellular stain was performed on HeLa cells with p53 (PAb240) NB200-103AF647 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
Flow Cytometry: p53 Antibody (PAb 240) [NB200-103] - An intracellular stain was performed on A549 cells with p53 (PAb240) NB200-103AF488 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 10 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 488.
Flow (Intracellular): p53 Antibody (PAb 240) [NB200-103] - An intracellular stain was performed on HeLa cells with p53 (PAb240) NB200-103 (blue) and a matched isotype control NBP2-27287 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature, followed by APC-conjugated anti-mouse IgG secondary antibody F0101B.
(3 Reviews)
(34 Publications)
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
p73 Antibody
(5B429) - BSA Free
NBP2-24737
Western Blot: p73 Antibody (5B429) [NBP2-24737] - Consequences of DHX9 knockdown on protein levels of p53 targets in HCT116 p53+/+ and p53-/- cells. Western blot analysis of p53 transcriptional targets in HCT116 p53+/+ and p53-/- cells. Cells were harvested 6 days post-transduction and extracts were fractionated on 8% SDS-PAGE gels. All probings were performed on the same blot. Actin and eEF2 are used as loading controls. Quantitation of intensity levels of the proteins in the shDHX9 samples relative to the shFLuc. 1309 samples are indicated beneath each band. Image collected and cropped by CiteAb from the following publication (https://www.oncotarget.com/article/15889/text/), licensed under a CC-BY licence.
Western Blot: p73 Antibody (5B429) [NBP2-24737] - Analysis of p73 in A) transfected cell lysate and B) HeLa cell lysate at 2 ug/ml.
Immunohistochemistry-Paraffin: p73 Antibody (5B429) [NBP2-24737] - FFPE breast cancer probed with p73 antibody at 5 ug/ml. Human tissue was used for this test. Staining of tissues is enhanced by boiling tissue sections in 10 mM sodium citrate buffer, pH 6.0 for 10-20 min followed by cooling at RT for 20 min.
(57 Publications)
Species: Hu, Mu, Rt
Applications: ChIP, CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
PUMA Antibody -
BSA Free
NBP1-76639
Western Blot: PUMA Antibody [NBP1-76639] - Independent Antibody Validation (IAV) via Protein Expression ProfileLoading: 20 ug of lysates per lane.Antibodies: NBP1-76654 (3 ug/mL), NBP1-76639 (2 ug/mL), beta-actin (1 ug/mL) and GAPDH (0.02 ug/mL), 1 h incubation at RT in 5% NFDM/TBST.Secondary: Goat anti-rabbit IgG HRP conjugate.
Immunohistochemistry: PUMA Antibody [NBP1-76639] - Analysis of PUMA in human breast tissue with PUMA antibody at 2.5 ug/ml.
Western Blot: PUMA Antibody [NBP1-76639] - Identification of target for LPS-induced miR-29b in OCs. BMMs were incubated with M-CSF (30 ng/ml) and RANKL (40 ng/ml) for 40 h, washed thoroughly, and incubated further with LPS (50 ng/ml) in the presence of M-CSF (30 ng/ml) for 48 h. Cells were transfected with 30 nM of miR-29b mimic or con mimic in the presence of M-CSF (30 ng/ml) for 6 h. Total RNA was analyzed by qPCR to quantify the expression of BMF, PUMA, BAK1, BIM, and HRK. Expression levels with con mimic treatment were set at 1. Cell lysates were subjected to Western blot analysis with antibodies against BMF, PUMA, BAK1, BIM, HRK, and BCL-2. Antibodies against beta-actin were used for normalization. Image collected and cropped by CiteAb from the following publication (https://www.hindawi.com/journals/omcl/2019/6018180/) licensed under a CC-BY licence.
(7 Publications)
Species: Hu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
ARHGAP24 Antibody
NBP1-84161
Immunohistochemistry-Paraffin: ARHGAP24 Antibody [NBP1-84161] - Staining of human kidney shows cytoplasmic positivity in renal tubules.
(1 Publication)
Species: Hu
Applications: IHC, IHC-P
PDCD6 Antibody
[Unconjugated]
AF6015
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line, Hepa 1‑6 mouse hepatoma cell line, and NRK rat normal kidney cell line. PVDF Membrane was probed with 1 µg/mL of Sheep Anti-Human/Mouse/Rat PDCD6 Polyclonal Antibody (Catalog # AF6015) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for PDCD6 at approximately 22 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 2.
Species: Hu, Mu, Rt
Applications: WB
MAGI2 Antibody
AF7117
Western blot shows lysates of human brain (cortex) tissue. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human MAGI2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF7117) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). A specific band was detected for MAGI2 at approximately 170 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
MAGI2 was detected in immersion fixed paraffin-embedded sections of human brain (hippocampus) using Goat Anti-Human MAGI2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF7117) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific staining was localized to synaptic boutons and neuronal processes. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
MAGI2 was detected in immersion fixed U‑87 MG human glioblastoma/astrocytoma cell line using Goat Anti-Human MAGI2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF7117) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(1 Publication)
Species: Hu, Mu
Applications: ICC, IHC, WB
Alix Antibody
NBP1-90201
Western Blot: Alix Antibody [NBP1-90201] - Analysis in U-138MG cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-PDCD6IP antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Immunocytochemistry/Immunofluorescence: Alix Antibody [NBP1-90201] - Staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Alix Antibody [NBP1-90201] - Staining of human gastrointestinal shows moderate cytoplasmic positivity in glandular cells.
(1 Review)
(10 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Bax Antibody (6A7)
NBP1-28566
Western Blot: Bax Antibody (6A7) [NBP1-28566] - Analysis of lysates from human metastatic pancreatic cancer cell line L3.6pl using Bax Antibody (clone 6A7; Lot # B168-P780E). This image was submitted via reviews by a varified end user.
Western Blot: Bax Antibody (6A7) [NBP1-28566] - rOPN administration elevated the expression of autophagy-related proteins while suppressing apoptosis in rat brain at 24 h after SAH. The effects of rOPN on expression levels of Bax, mean +/- SD is 1.006 +/- 0.321 in Sham group, 37.47 +/- 10.86 in SAH + Vehicle group, 23.83 +/- 8.143 in SAH + rOPN group, F = 33.13, in the left hemisphere of rat brain at 24 h after SAH. Sample size is 18, n = 6 per group. Data were presented as mean +/- SD. *P < .05, ***P < .001 vs Sham group; #P < .05, ##P < .01 vs SAH + Vehicle group Image collected and cropped by CiteAb from the following publication (https://onlinelibrary.wiley.com/doi/abs/10.1111/cns.13199) licensed under a CC-BY licence.
Immunohistochemistry-Frozen: Bax Antibody (6A7) [NBP1-28566] - Mouse retina with no pretreatment. IHC-F image submitted by a verified customer review
(3 Reviews)
(18 Publications)
Species: Bv, Hu, Pm, Mu, Po, Rt
Applications: Func, IHC, IHC-Fr, IHC-P, WB
Calnexin Antibody
- BSA Free
NB100-1965
Western Blot: Calnexin Antibody [NB100-1965] - Subcellular localization of TM6SF2.Immunoaffinity isolation of ER and Golgi complex from mouse liver. ER and Golgi fractions were prepared from mouse liver microsomes by immunoaffinity chromatography as described under Experimental Procedures. Microsome membranes were dissolved in RIPA buffer, and equal volumes were separated on 10% SDS-PAGE and immunoblotting as described under Experimental Procedures. BiP, binding immunoglobulin protein; Gos28, Golgi SNAP receptor complex member 1; *, nonspecific band. Image collected and cropped by Citeab from the following publication (Inactivation of Tm6sf2, a Gene Defective in Fatty Liver Disease, Impairs Lipidation but Not Secretion of Very Low Density Lipoproteins. J Biol Chem (2016) licensed under a CC-BY licence.
Immunohistochemistry: Calnexin Antibody [NB100-1965] - Calnexin immunostaining in the anterior (AI) and mid (MI) intestine of ctrl (control zebrafish), D.I.O. (diet-induced obesity zebrafish), D.I.O. flw 3,5-T2 (D.I.O. zebrafish followed by 3,5-T2), D.I.O. with 3,5-T2 (D.I.O. zebrafish treated with 3,5-T2). (A) AI of ctrl zebrafish (B) AI of D.I.O. (C) AI of D.I.O. flw 3,5-T2. (D) AI of D.I.O. with 3,5-T2. The arrows indicate calnexin immunoexpression in the enteroendocrine and goblet cells. Image collected and cropped by CiteAb from the following publication (https://www.mdpi.com/2076-2615/10/7/1131/htm#) licensed under a CC-BY licence.
Immunohistochemistry: Calnexin Antibody [NB100-1965] - IHC analysis of CANX in mouse prostate using DAB with hematoxylin counterstain.
(3 Reviews)
(31 Publications)
Species: Av, Bv, Ch, Dr, Gp, Hu, Mu, Po, Rb, Rt, Sh, Xp, Ze
Applications: Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
ACTRT1 Antibody
NBP2-15278
Immunohistochemistry-Paraffin: ACTRT1 Antibody [NBP2-15278] - Paraffin-embedded U87 xenograft, using antibody at 1:500 dilution.
Western Blot: ACTRT1 Antibody [NBP2-15278] - Sample (30 ug of whole cell lysate) A: PC-3 10% SDS PAGE; antibody diluted at 1:1000.
Species: Hu
Applications: IHC, IHC-P, WB
IFN-alpha 1
Antibody
NBP2-75930
Western Blot: IFN-alpha 1 Antibody [NBP2-75930] - analysis of IFNA1 on mouse liver tissue lysate using anti-IFNA1 antibody at 1/100 dilution.
Immunocytochemistry/Immunofluorescence: IFN-alpha 1 Antibody [NBP2-75930] - staining IFNA1 in N2A cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunocytochemistry/Immunofluorescence: IFN-alpha 1 Antibody [NBP2-75930] - staining IFNA1 in SHG-44 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
TSG101 Antibody
(4A10)
NB200-112
Western Blot: TSG101 Antibody (4A10) [NB200-112] - Lane 1: MWM, Lane 2: TSG101 in RAW 264.7 Whole Cell Lysate, Lane 3: Exosome Lysate. Used primary antibody at 1:500 and Donkey Anti-Mouse at 0.5 ug/mL (this could be titrated down to reduce background). Used picogram sensitivity ECL reagents. Image from verified customer review.
Flow Cytometry: TSG101 Antibody (4A10) [NB200-112] - An intracellular stain was performed on HeLa cells with TSG101 Antibody (4A10) NB200-112F (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to FITC.
Flow Cytometry: TSG101 Antibody (4A10) [NB200-112] - An intracellular stain was performed on Hek293 cells with TSG101 Antibody [4A10] NB200-112PE (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Phycoerythrin.
(2 Reviews)
(89 Publications)
Species: Ca, Ha, Hu, Pm, Mu, Po, Pm, Rt
Applications: EM, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-P, IP, KD, WB
ARMER Antibody
NBP1-77198
Immunofluorescence: ARMER Antibody [NBP1-77198] - Immunofluorescence of ARMER in Mouse Intestine cells with ARMER antibody at 2 ug/mL.
Immunohistochemistry-Paraffin: ARMER Antibody [NBP1-77198] - Staining of Human bladder tissue at 2 ug/ml.
Western Blot: ARMER Antibody [NBP1-77198] - Analysis of ARMER in human bladder cell lysates with anti-ARMER (CT) using NBP1-77198 at (A) 0.5, (B) 1, and (C) 2 ug/ml.
(1 Review)
Species: Hu, Mu
Applications: ELISA, IF, IHC, IHC-P, WB
Cyclin B1 Antibody
[Unconjugated]
AF6000
Cyclin B1 was detected in immersion fixed paraffin-embedded sections of human lymphoma using Goat Anti-Human/Mouse Cyclin B1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6000) at 10 µg/mL overnight at 4 °C. Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counter­stained with hematoxylin (blue). Specific staining was localized to cytoplasm in lymphocytes. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Western blot shows lysates of U2OS human osteosarcoma cell line, K562 human chronic myelogenous leukemia cell line, HeLa human cervical epithelial carcinoma cell line, and Jurkat human acute T cell leukemia cell line. PVDF Membrane was probed with 0.2 µg/mL of Goat Anti-Human/Mouse Cyclin B1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6000) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for Cyclin B1 at approximately 62 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of HeLa human cervical epithelial carcinoma cell line and Jurkat human acute T cell leukemia cell line, loaded at 0.2 mg/mL. A specific band was detected for Cyclin B1 at approximately 67 kDa (as indicated) using 2 µg/mL of Goat Anti-Human/Mouse Cyclin B1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6000) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
(6 Publications)
Species: Hu, Mu
Applications: IHC, Simple Western, WB
cIAP-2/HIAP-1
Antibody - BSA Free
NBP1-27972
Immunocytochemistry/Immunofluorescence: cIAP-2/HIAP-1 Antibody [NBP1-27972] - HIAD1 staining in Hela cells detected with a Dylight 488 labeled secondary antibody (Green) with Hoechst 33258 nuclear counterstain (Blue).
Simple Western: cIAP-2/HIAP-1 Antibody [NBP1-27972] - Simple Western lane view shows a specific band for Ciap2 in 0.5 mg/ml of HepG2 lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system. *Non-specific interaction with the 230 kDa standard may be seen with this antibody.
Immunohistochemistry: cIAP-2/HIAP-1 Antibody [NBP1-27972] - Analysis of human adenocarcinoma cells and adjacent glands using anti-cIAP2.
(1 Review)
(2 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Bax inhibitor 1
Antibody (20F430)
NBP2-24919
Immunohistochemistry-Paraffin: Bax inhibitor 1 Antibody (20F430) [NBP2-24919] - Formalin-fixed, paraffin-embedded human adenocarcinoma of the rectum stained with Bi-1 antibody (5 ug/ml), peroxidase-conjugate and DAB chromogen. Staining of formalin-fixed tissues is enhanced by boiling tissue sections in 10 mM sodium citrate buffer, pH 6.0 for 10-20 min followed by cooling at RT for 20 min.
Immunohistochemistry-Paraffin: Bax inhibitor 1 Antibody (20F430) [NBP2-24919] - IHC analysis of formalin-fixed paraffin-embedded tissue section of human liver cancer using 5 ug/ml concentration of Bax inhibitor 1 antibody (clone 20F430). Intense cytoplasmic immune-positivity of Bax inhibitor 1 (TMBIM6) was observed in the hepatis cancer cells [10X Magnification]
Immunohistochemistry-Paraffin: Bax inhibitor 1 Antibody (20F430) [NBP2-24919] - Formalin-fixed, paraffin-embedded normal human tissue sections stained for Bi-1 expression using this antibody at 5 ug/ml. A: liver. B: skin. Hematoxylin-eosin counterstain.
(2 Publications)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
DAB2IP Antibody
NBP1-30081
Western Blot: DAB2IP Antibody [NBP1-30081] - Whole cell lysate from HeLa cells. DAB2IP was also IPed by rabbit anti-DAB2IP antibody NBP1-30082. For blotting immunoprecipitated DAB2IP, the ReliaBLOT (Trademark) Reagents and Procedures were used.
Western Blot: DAB2IP Antibody [NBP1-30081] - Detection of Mouse DAB2IP by Western Blot. Samples: Whole cell lysate (50 ug) from TCMK-1, Renca, 4T1, and CT26.WT cells. Antibodies: Affinity purified rabbit anti-DAB2IP antibody NBP1-30081 used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 3 minutes.
(1 Publication)
Species: Hu, Mu
Applications: IP, WB
Fas/TNFRSF6/CD95
[HRP]
DFS00
(17 Publications)
Species: Hu
Applications: ELISA
WDR1 Antibody
NBP2-32665
Western Blot: WDR1 Antibody [NBP2-32665] - Analysis in human cell line MOLT-4.
Immunohistochemistry-Paraffin: WDR1 Antibody [NBP2-32665] - Staining of human endometrium shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: WDR1 Antibody [NBP2-32665] - Staining of human prostate shows moderate cytoplasmic positivity in smooth muscle and glandular cells.
Species: Hu
Applications: IHC, IHC-P, WB
SHISA5 Recombinant
Protein Antigen
NBP1-83190PEP
SHISA5 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for SHISA5 Protein (NBP1-83190PEP) (0)

There are no publications for SHISA5 Protein (NBP1-83190PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SHISA5 Protein (NBP1-83190PEP) (0)

There are no reviews for SHISA5 Protein (NBP1-83190PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SHISA5 Protein (NBP1-83190PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SHISA5 Products

Bioinformatics Tool for SHISA5 Protein (NBP1-83190PEP)

Discover related pathways, diseases and genes to SHISA5 Protein (NBP1-83190PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SHISA5 Protein (NBP1-83190PEP)

Discover more about diseases related to SHISA5 Protein (NBP1-83190PEP).
 

Pathways for SHISA5 Protein (NBP1-83190PEP)

View related products by pathway.

Blogs on SHISA5

There are no specific blogs for SHISA5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Western Blot: TSG101 Antibody (4A10) [NB200-112] - Lane 1: MWM, Lane 2: TSG101 in RAW 264.7 Whole Cell Lysate, Lane 3: Exosome Lysate. Used primary antibody at 1:500 and Donkey Anti-Mouse at 0.5 ug/mL (this could be titrated down to reduce background). Used picogram sensitivity ECL reagents. Image from verified customer review.
TSG101 Antibody (4A10)
NB200-112

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SHISA5 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol SHISA5