SHFM3 Recombinant Protein Antigen

Images

 
There are currently no images for SHFM3 Protein (NBP2-14013PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

SHFM3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FBXW4.

Source: E. coli

Amino Acid Sequence: QCLHTIQTEDRVWSIAISPLLSSFVTGTACCGHFSPLRIWDLNSGQLMTHLGSDFPPGAGVLDVMYESPFTLLSCGYD

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
FBXW4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-14013.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SHFM3 Recombinant Protein Antigen

  • DAC
  • dactylin
  • F-box and WD repeat domain containing 4
  • F-box and WD-40 domain protein 4
  • F-box and WD-40 domain-containing protein 4
  • F-box/WD repeat protein 4
  • F-box/WD repeat-containing protein 4
  • Fbw4
  • FBW4split hand/foot malformation (ectrodactyly) type 3
  • FBWD4
  • SHFM3
  • SHSF3

Background

SHFM3 is a member of the F-box/WD-40 gene family, which recruit specific target proteins through their WD-40 protein-protein binding domains for ubiquitin mediated degradation. In mouse, a highly similar protein is thought to be responsible for maintaining the apical ectodermal ridge of developing limb buds; disruption of the mouse gene results in the absence of central digits, underdeveloped or absent metacarpal/metatarsal bones and syndactyly. This phenotype is remarkably similar to split hand-split foot malformation in humans, a clinically heterogeneous condition with a variety of modes of transmission. An autosomal recessive form has been mapped to the chromosomal region where this gene is located, and complex rearrangements involving duplications of this gene and others have been associated with the condition. A pseudogene of this locus has been mapped to one of the introns of the BCR gene on chromosome 22. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1916
Species: Hu
Applications: ICC, IHC, WB
NB100-56519
Species: Bv, Hu, Mu, Po, Rt, Sh
Applications: ChIP, CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, KD, Simple Western, WB
423-F8
Species: Hu, Mu
Applications: BA
H00007001-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, KD, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-27192
Species: Bv, Ca, Ch, Eq, Hu, Mu, Pm
Applications: IHC,  IHC-P, WB
NB100-41398
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
H00171023-M05
Species: Hu
Applications: ELISA, IP, WB
NBP1-87769
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-89827
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-47714
Species: Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-47291
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP2-92546
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, WB
M6000B
Species: Mu
Applications: ELISA
NB300-731
Species: Gp, Hu, Mu, Rb, Rt, Sh, Ye
Applications: B/N, ChIP, Flow, GS, ICC/IF, IHC,  IHC-P, IP, WB
NBP2-14013PEP
Species: Hu
Applications: AC

Publications for SHFM3 Protein (NBP2-14013PEP) (0)

There are no publications for SHFM3 Protein (NBP2-14013PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SHFM3 Protein (NBP2-14013PEP) (0)

There are no reviews for SHFM3 Protein (NBP2-14013PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SHFM3 Protein (NBP2-14013PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SHFM3 Products

Research Areas for SHFM3 Protein (NBP2-14013PEP)

Find related products by research area.

Blogs on SHFM3

There are no specific blogs for SHFM3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SHFM3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol FBXW4