Recombinant Human SHFM3 Protein

Images

 
SDS-Page: Recombinant Human SHFM3 Protein [H00006468-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP

Order Details

Recombinant Human SHFM3 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 41-140 of Human SHFM3

Source: Wheat Germ

Amino Acid Sequence: SYLDMRALGRLAQVCRWLRRFTSCDLLWRRIARASLNSGFTRLGTDLMTSVPVKERVKVSQNWRLGRCREGILLKWRCSQMPWMQLEDDSLYISQANFIL

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
FBXW4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SHFM3 Protein

  • DAC
  • dactylin
  • F-box and WD repeat domain containing 4
  • F-box and WD-40 domain protein 4
  • F-box and WD-40 domain-containing protein 4
  • F-box/WD repeat protein 4
  • F-box/WD repeat-containing protein 4
  • Fbw4
  • FBW4split hand/foot malformation (ectrodactyly) type 3
  • FBWD4
  • SHFM3
  • SHSF3

Background

FBXW4 - F-box and WD-40 domain protein 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1916
Species: Hu
Applications: WB, IHC, ICC
NB100-56519
Species: Hu, Mu, Rt, Po, Sh
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC, IHC-FrFl
H00007001-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-27192
Species: Hu, Mu, Bv, Ca, Ch, Eq, Pm
Applications: WB, IHC-P
NB100-41398
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-91148
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00171023-M05
Species: Hu
Applications: WB, ELISA, IP
NBP1-87769
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89827
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47714
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-75656
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-91612
Species: Mu
Applications: WB
7270-IL/CF
Species: Hu
NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, B/N

Publications for SHFM3 Partial Recombinant Protein (H00006468-Q01) (0)

There are no publications for SHFM3 Partial Recombinant Protein (H00006468-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SHFM3 Partial Recombinant Protein (H00006468-Q01) (0)

There are no reviews for SHFM3 Partial Recombinant Protein (H00006468-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SHFM3 Partial Recombinant Protein (H00006468-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SHFM3 Products

Bioinformatics Tool for SHFM3 Partial Recombinant Protein (H00006468-Q01)

Discover related pathways, diseases and genes to SHFM3 Partial Recombinant Protein (H00006468-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SHFM3 Partial Recombinant Protein (H00006468-Q01)

Discover more about diseases related to SHFM3 Partial Recombinant Protein (H00006468-Q01).
 

Pathways for SHFM3 Partial Recombinant Protein (H00006468-Q01)

View related products by pathway.

PTMs for SHFM3 Partial Recombinant Protein (H00006468-Q01)

Learn more about PTMs related to SHFM3 Partial Recombinant Protein (H00006468-Q01).
 

Research Areas for SHFM3 Partial Recombinant Protein (H00006468-Q01)

Find related products by research area.

Blogs on SHFM3

There are no specific blogs for SHFM3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SHFM3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol FBXW4