SHC3 Antibody (1C11)

Images

 
Sandwich ELISA: SHC3 Antibody (1C11) [H00053358-M04] - Detection limit for recombinant GST tagged SHC3 is 0.03 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
1C11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

SHC3 Antibody (1C11) Summary

Immunogen
SHC3 (NP_058544.2, 381 a.a. ~ 480 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QGRHLGDTFGEDWQQTPLRQGSSDIYSTPEGKLHVAPTGEAPTYVNTQQIPPQAWPAAVSSAESSPRKDLFDMKPFEDALKNQPLGPVLSKAASVECISP
Specificity
SHC3 - SHC (Src homology 2 domain containing) transforming protein 3 (1C11)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SHC3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SHC3 Antibody (1C11)

  • Neuronal Shc
  • NSHCDKFZp686H1544
  • N-Shcsrc homology 2 domain containing transforming protein C3
  • Protein Rai
  • RAI
  • SH2 domain protein C3
  • SHC (Src homology 2 domain containing) transforming protein 3
  • SHCCFLJ45325
  • SHC-transforming protein 3
  • SHC-transforming protein C
  • src homology 2 domain-containing transforming protein C3
  • Src homology 2 domain-containing-transforming protein C3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-02434
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP1-87076
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-34294
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
DBD00
Species: Hu
Applications: ELISA
AF1056
Species: Rt
Applications: IHC, WB
DCRP00
Species: Hu
Applications: ELISA
NBP2-48732
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
AF482
Species: Mu
Applications: IHC, WB
AF2685
Species: Hu
Applications: IHC, Simple Western, WB
NBP2-25250
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NBP2-80405
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB110-60490
Species: Hu
Applications: ELISA, IHC, IHC-P, WB
NBP2-67360
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
7268-CT
Species: Hu
Applications: BA
NB300-560
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr, IHC-P, WB
688-TK
Species: Hu
Applications: BA
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
H00053358-M04
Species: Hu
Applications: WB, ELISA, S-ELISA

Publications for SHC3 Antibody (H00053358-M04) (0)

There are no publications for SHC3 Antibody (H00053358-M04).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SHC3 Antibody (H00053358-M04) (0)

There are no reviews for SHC3 Antibody (H00053358-M04). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SHC3 Antibody (H00053358-M04) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SHC3 Products

Bioinformatics Tool for SHC3 Antibody (H00053358-M04)

Discover related pathways, diseases and genes to SHC3 Antibody (H00053358-M04). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SHC3 Antibody (H00053358-M04)

Discover more about diseases related to SHC3 Antibody (H00053358-M04).
 

Pathways for SHC3 Antibody (H00053358-M04)

View related products by pathway.

PTMs for SHC3 Antibody (H00053358-M04)

Learn more about PTMs related to SHC3 Antibody (H00053358-M04).

Blogs on SHC3

There are no specific blogs for SHC3, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SHC3 Antibody (1C11) and receive a gift card or discount.

Bioinformatics

Gene Symbol SHC3
Entrez
Uniprot