SHBG Antibody (5E6) - Azide and BSA Free Summary
| Description |
Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen |
SHBG (NP_001031, 41 a.a. ~ 140 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DPPAVHLSNGPGQEPIAVMTFDLTKITKTSSSFEVRTWDPEGVIFYGDTNPKDDWFMLGLRDGRPEIQLHNHWAQLTVGAGPRLDDGRWHQVEVKMEGDS |
| Specificity |
SHBG (5E6) |
| Isotype |
IgG2b Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
SHBG |
| Purity |
IgG purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Sandwich ELISA
- Western Blot
|
| Application Notes |
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA. |
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
In 1x PBS, pH 7.4 |
| Preservative |
No Preservative |
| Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for SHBG Antibody (5E6) - Azide and BSA Free
Background
The gene encodes an EF hand-containing small calcium binding protein. It is an integral subunit component of Kv4/D (Shal)-type voltage-gated rapidly inactivating A-type potassium channels. Kv4 potassium channels regulate action potentials in neurons and cardiac myocytes. The coexpression of ABP with pore-forming Kv4 alpha subunits causes changes in the gating and amplitude of Kv4 currents, thus profoundly affect the intracellular trafficking and molecular properties of Kv4.2 alpha subunits. It also cause a dramatic redistribution of Kv4.2, releasing intrinsic endoplasmic reticulum retention and allowing for trafficking to the cell surface. It may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. It maps to 5q35.1 region of human chromosome. Alternative splicing results in multiple transcript variant encoding different isoforms. Isoform 1 and isoform 2 are expressed in brain and kidney.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu, Mu
Applications: IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: BA
Species: Mu, Rt
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, Simple Western, WB
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Species: Hu
Applications: ICC, Neut, WB
Species: Mu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Rt
Applications: CyTOF-ready, ICC, IHC, ICFlow
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Ca, Hu, Mu, Po, Pm, Rt(-)
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO, PLA, WB
Species: Hu, Mu
Applications: IHC, IHC-P
Species: Hu
Applications: ELISA
Species: Hu
Applications: WB, ELISA
Publications for SHBG Antibody (H00006462-M01) (0)
There are no publications for SHBG Antibody (H00006462-M01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for SHBG Antibody (H00006462-M01) (0)
There are no reviews for SHBG Antibody (H00006462-M01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for SHBG Antibody (H00006462-M01) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional SHBG Products
Research Areas for SHBG Antibody (H00006462-M01)
Find related products by research area.
|
Blogs on SHBG