SHBG Antibody (5E6.)

Images

 
Western Blot: SHBG Antibody (5E6) [H00006462-M01] - SHBG monoclonal antibody (M01), clone 5E6 Analysis of SHBG expression in HepG2.
Sandwich ELISA: SHBG Antibody (5E6) [H00006462-M01] - Detection limit for recombinant GST tagged SHBG is 1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
5E6.
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

SHBG Antibody (5E6.) Summary

Immunogen
SHBG (NP_001031, 41 a.a. - 140 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DPPAVHLSNGPGQEPIAVMTFDLTKITKTSSSFEVRTWDPEGVIFYGDTNPKDDWFMLGLRDGRPEIQLHNHWAQLTVGAGPRLDDGRWHQVEVKMEGDS
Specificity
SHBG (5E6)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SHBG
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SHBG Antibody (5E6.)

  • ABP
  • ABPTestosterone-estrogen-binding globulin
  • androgen binding protein
  • MGC126834
  • MGC138391
  • SBP
  • sex hormone-binding globulin
  • Sex steroid-binding protein
  • SHBG
  • TEBG
  • Testis-specific androgen-binding protein
  • testosterone-binding beta-globulin
  • Testosterone-estradiol-binding globulin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-38770
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-30475
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
AF682
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF5828
Species: Hu
Applications: WB, ICC, Neut
MAB3838
Species: Rt
Applications: WB, IHC
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
MAB1419
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
NB300-164
Species: Hu, Po, Ca, Rt(-)
Applications: WB, ICC/IF, IHC-Fr, IHC-P, IP
NB120-7164
Species: Hu, Mu, Rt, Fi
Applications: ELISA, ICC/IF, IHC-Fr, MiAr
H00006462-M01
Species: Hu
Applications: WB, ELISA

Publications for SHBG Antibody (H00006462-M01) (0)

There are no publications for SHBG Antibody (H00006462-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SHBG Antibody (H00006462-M01) (0)

There are no reviews for SHBG Antibody (H00006462-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SHBG Antibody (H00006462-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SHBG Products

Bioinformatics Tool for SHBG Antibody (H00006462-M01)

Discover related pathways, diseases and genes to SHBG Antibody (H00006462-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SHBG Antibody (H00006462-M01)

Discover more about diseases related to SHBG Antibody (H00006462-M01).
 

Pathways for SHBG Antibody (H00006462-M01)

View related products by pathway.

PTMs for SHBG Antibody (H00006462-M01)

Learn more about PTMs related to SHBG Antibody (H00006462-M01).
 

Research Areas for SHBG Antibody (H00006462-M01)

Find related products by research area.

Blogs on SHBG

There are no specific blogs for SHBG, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SHBG Antibody (5E6.) and receive a gift card or discount.

Bioinformatics

Gene Symbol SHBG
Entrez
OMIM
Uniprot