SH3PXD2A Antibody

Western Blot: SH3PXD2A Antibody [NBP1-90454] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Immunohistochemistry-Paraffin: SH3PXD2A Antibody [NBP1-90454] - Staining of human cervix, uterine shows moderate cytoplasmic positivity in squamous epithelial cells.

Western Blot: SH3PXD2A Antibody [NBP1-90454] - Analysis in human cell line HeLa.

Immunohistochemistry-Paraffin: SH3PXD2A Antibody [NBP1-90454] - Staining of human pancreas shows very weak positivity in exocrine glandular cells and strong positivity in endocrine glandular cells.

Immunohistochemistry-Paraffin: SH3PXD2A Antibody [NBP1-90454] - Staining of human skin shows moderate cytoplasmic positivity in squamous epithelial cells.

Immunohistochemistry-Paraffin: SH3PXD2A Antibody [NBP1-90454] - Staining of human prostate shows moderate cytoplasmic positivity in smooth muscle cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

SH3PXD2A Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PDPSGKELDTVPAKGRQNEGKSDSLEKIERRVQALNTVNQSKKATPPIPSKPPGGFGKTSGTPAVKMRNGVRQVAVRPQSVFVSP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SH3PXD2A
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  SH3PXD2A Protein (NBP1-90454PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SH3PXD2A Antibody

• adaptor protein TKS5
• SH3 and PX domains 2A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SH3PXD2A