SH3GLB2 Antibody

Images

 
Western Blot: SH3GLB2 Antibody [NBP1-81367] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-526
Immunocytochemistry/ Immunofluorescence: SH3GLB2 Antibody [NBP1-81367] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
Immunohistochemistry: SH3GLB2 Antibody [NBP1-81367] - Staining of human rectum shows moderate positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SH3GLB2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: RRLDLDACKARLKKAKAAEAKATTVPDFQETRPRNYILSASASALWNDEVDKAEQELRVAQTEFDRQAEVTRLLLEGISSTH
Specificity
Specificity of human SH3GLB2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SH3GLB2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SH3GLB2 Protein (NBP1-81367PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SH3GLB2 Antibody

  • endophilin-B2
  • GRB2-like, endophilin B2
  • SH3-containing protein SH3GLB2
  • SH3-domain GRB2-like endophilin B2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-81776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-61849
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-22380
Species: Hu
Applications: WB, IHC, IHC-P
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, ICC, IHC-FrFl
NBP1-84956
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00002316-M01
Species: Hu
Applications: WB, ELISA, IHC-P, PLA
NB300-221
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Eq, Fe, Ha, Op, Pm, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IP
MAB2018
Species: Hu, Mu, Rt
Applications: WB, Simple Western, CyTOF-reported, ICC, ICFlow
AF5415
Species: Hu
Applications: WB, IHC, ICC
NBP1-85521
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-46383
Species: Hu
Applications: WB, Flow, IHC
NB300-560
Species: Hu, Mu, Rt, Av, Bv, Pm
Applications: WB, IHC, IHC-Fr, IHC-P, IF
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP1-80669
Species: Hu
Applications: IHC, IHC-P
AF4075
Species: Mu, Rt
Applications: WB, IHC
NBP1-81367
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for SH3GLB2 Antibody (NBP1-81367) (0)

There are no publications for SH3GLB2 Antibody (NBP1-81367).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SH3GLB2 Antibody (NBP1-81367) (0)

There are no reviews for SH3GLB2 Antibody (NBP1-81367). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SH3GLB2 Antibody (NBP1-81367) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for SH3GLB2 Antibody (NBP1-81367)

Discover related pathways, diseases and genes to SH3GLB2 Antibody (NBP1-81367). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SH3GLB2 Antibody (NBP1-81367)

Discover more about diseases related to SH3GLB2 Antibody (NBP1-81367).
 

Pathways for SH3GLB2 Antibody (NBP1-81367)

View related products by pathway.

PTMs for SH3GLB2 Antibody (NBP1-81367)

Learn more about PTMs related to SH3GLB2 Antibody (NBP1-81367).

Blogs on SH3GLB2

There are no specific blogs for SH3GLB2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SH3GLB2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SH3GLB2