SH3GL3 Antibody

Images

 
Western Blot: SH3GL3 Antibody [H00006457-B01P] - Analysis of SH3GL3 expression in rat brain.
Western Blot: SH3GL3 Antibody [H00006457-B01P] - Analysis of SH3GL3 expression in transfected 293T cell line by SH3GL3 polyclonal antibody. Lane 1: SH3GL3 transfected lysate(31.68 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

SH3GL3 Antibody Summary

Immunogen
SH3GL3 (AAH42864.1, 1 a.a. - 288 a.a.) full-length human protein. MSVAGLKKQFHKASQLFSEKISGAEGTKLDDEFLDMERKIDVTNKVVAEILSKTTEYLQPNPAYRAKLGMLNTVSKIRGQVKTTGYPQTEGLLGDCMLKYGKELGEDSTFGNALIEVGESMKLMAEVKDSLDINVKQTFIDPLQLLQDKDLKEIGHHLKKLEGRRLDYDYKKKRVGKIPDEEVRQAVEKFEESKELAERSMFNFLENDVEQVSQLAVFIEAALDYHRQSTEILQELQSKLQMRISAASSVPRREYKPRPVKRSSSELNGVSTTSVVKTTAYSRLEPAD
Specificity
SH3GL3 - SH3-domain GRB2-like 3,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
SH3GL3
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SH3GL3 Antibody

  • CNSA3
  • EEN-B2
  • endophilin-A3
  • SH3D2C
  • SH3-domain GRB2-like 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-75531
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF8006
Species: Hu, Mu, Rt
Applications: WB
NBP2-02834
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00006532-D01P
Species: Hu, Mu
Applications: WB, Flow
H00005046-A01
Species: Hu, Mu, Rt
Applications: WB, ELISA
MAB1790
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-90201
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
AF1280
Species: Mu
Applications: WB, Simple Western, IHC
NBP1-86033
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88779
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-717
Species: Hu, Mu, Rt, Po, Bv, Ch, GP, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NBP1-90063
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82236
Species: Hu
Applications: WB, IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NB110-60491
Species: Hu, Mu
Applications: WB, Simple Western, ELISA, Flow, IHC, IHC-Fr, IHC-P
NBP1-87842
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB7740
Species: Mu
Applications: WB
H00004340-B01P
Species: Hu, Rt
Applications: WB
NB100-866
Species: Hu, Mu, Rt, Po
Applications: WB, IHC, IHC-P, PEP-ELISA
H00006457-B01P
Species: Hu, Rt
Applications: WB

Publications for SH3GL3 Antibody (H00006457-B01P) (0)

There are no publications for SH3GL3 Antibody (H00006457-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SH3GL3 Antibody (H00006457-B01P) (0)

There are no reviews for SH3GL3 Antibody (H00006457-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SH3GL3 Antibody (H00006457-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SH3GL3 Products

Bioinformatics Tool for SH3GL3 Antibody (H00006457-B01P)

Discover related pathways, diseases and genes to SH3GL3 Antibody (H00006457-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SH3GL3 Antibody (H00006457-B01P)

Discover more about diseases related to SH3GL3 Antibody (H00006457-B01P).
 

Pathways for SH3GL3 Antibody (H00006457-B01P)

View related products by pathway.

PTMs for SH3GL3 Antibody (H00006457-B01P)

Learn more about PTMs related to SH3GL3 Antibody (H00006457-B01P).

Blogs on SH3GL3

There are no specific blogs for SH3GL3, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SH3GL3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SH3GL3
Entrez
Uniprot
COVID-19 update