SH3D19 Antibody

Images

 
Immunohistochemistry-Paraffin: SH3D19 Antibody [NBP1-84203] - Staining of human small intestine shows cytoplasmic and nuclear positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SH3D19 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:IFPANYVKVIIDIPEGGNGKRECVSSHCVKGSRCVARFEYIGEQKDELSFSEGEIIILKEYVNEEWARGEVRGRTGIFPLNFVEPVEDYPTSGANVLSTKVPLKTKKEDSGSNSQVNSLPAEWCEAL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SH3D19
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SH3D19 Protein (NBP1-84203PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SH3D19 Antibody

  • ADAM binding protein Eve-1
  • ADAM-binding protein Eve-1
  • DKFZp434D0215
  • EBPMGC118912
  • EEN binding protein
  • EEN-binding protein
  • EVE1
  • Kryn
  • MGC105136
  • MGC118910
  • MGC118911
  • MGC118913
  • SH3 domain containing 19
  • SH3 domain protein D19
  • SH3 domain-containing protein 19
  • SH3P19

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NB600-1335
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, GS, ICC/IF, IHC, IHC-P, IP
NB100-56530
Species: Hu
Applications: WB
MAB5526
Species: Hu, Mu
Applications: WB
NBP1-89544
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-46179
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-410
Species: Hu, Mu
Applications: WB, IP
NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
MAB6799
Species: Hu
Applications: WB, IHC

Publications for SH3D19 Antibody (NBP1-84203) (0)

There are no publications for SH3D19 Antibody (NBP1-84203).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SH3D19 Antibody (NBP1-84203) (0)

There are no reviews for SH3D19 Antibody (NBP1-84203). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SH3D19 Antibody (NBP1-84203) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SH3D19 Products

Bioinformatics Tool for SH3D19 Antibody (NBP1-84203)

Discover related pathways, diseases and genes to SH3D19 Antibody (NBP1-84203). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SH3D19 Antibody (NBP1-84203)

Discover more about diseases related to SH3D19 Antibody (NBP1-84203).
 

Pathways for SH3D19 Antibody (NBP1-84203)

View related products by pathway.

Blogs on SH3D19

There are no specific blogs for SH3D19, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SH3D19 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SH3D19