SH3BP5 Antibody - BSA Free

Western Blot: SH3BP5 Antibody [NBP1-80796] - Analysis in human cell lines MCF-7 and Caco-2 using anti-SH3BP5 antibody. Corresponding SH3BP5 RNA-seq data are presented for the same cell lines. Loading control: anti-GAPDH.

Immunocytochemistry/Immunofluorescence: SH3BP5 Antibody [NBP1-80796] - Staining of human cell line A-431 shows localization to nucleoplasm & nuclear bodies.

Immunohistochemistry-Paraffin: SH3BP5 Antibody [NBP1-80796] - Staining of human Prostate shows moderate granular cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: SH3BP5 Antibody [NBP1-80796] - Staining of human Kidney shows moderate granular cytoplasmic positivity in cells in tubules.

Immunohistochemistry-Paraffin: SH3BP5 Antibody [NBP1-80796] - Staining of human Pancreas shows very weak granular cytoplasmic positivity in exocrine glandular cells.

Immunohistochemistry-Paraffin: SH3BP5 Antibody [NBP1-80796] - Staining of human Testis shows moderate granular cytoplasmic positivity in cells in seminiferous ducts.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SH3BP5 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ETQSVSSFSSGPTSPSEMPDQFPAVVRPGSLDLPSPVSLSEFGMMFPVLGPRSECSGASSPECEVERGDRAEGAENKTSDKANNNRG
• Predicted Species: Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SH3BP5
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  SH3BP5 Protein (NBP1-80796PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SH3BP5 Antibody - BSA Free

• Sab
• SABSH3BP-5
• SH3 binding protein
• SH3 domain-binding protein 5
• SH3 domain-binding protein that preferentially associates with BTK
• SH3-domain binding protein 5 (BTK-associated)

Background

SH3BP5 (SH3 domain binding protein 5) binds to the SH3 domain of Bruton tyrosine kinase (BTK), a cytoplasmic tyrosine kinase crucial for the maturation of B-lineage cells. It inhibits the auto- and transphosphorylation activity of BTK and negatively regulates BTK-related cytoplasmic signaling in B-cells. SH3BP5 also interacts with JNK. The interaction with JNK occurs through a mitogen-activated protein KIM (kinase interaction motif) in a region distinct from the Bruton's tyrosine kinase-binding domain.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SH3BP5 Antibody (NBP1-80796)(3)

Publications using NBP1-80796

• Zhou W, Ouyang J, Hu N, Wang H Flavonoids from Hippophae rhamnoides Linn. Revert Doxorubicin-Induced Cardiotoxicity through Inhibition of Mitochondrial Dysfunction in H9c2 Cardiomyoblasts In Vitro International journal of molecular sciences 2023-02-06 [PMID: 36834585] (WB, Rat)
• Zhu X, Schrader JM, Irizarry BA et al. Impact of A beta 40 and A beta 42 Fibrils on the Transcriptome of Primary Astrocytes and Microglia Biomedicines 2022-11-19 [PMID: 36428550] (IHC-Fr, Rat)
  
  Details:
  Fifteen-month-old rTgF344-AD rat brain sections, dilution used 1:200
• Legartova S, Svobodova Kovarikova A, Behalova Suchankova J et al. Early recruitment of PARP-dependent m8A RNA methylation at DNA lesions is subsequently accompanied by active DNA demethylation RNA biology 2022-01-01 [PMID: 36382943] (WB, Human)

Bioinformatics

• Gene Symbol: SH3BP5
• Entrez:
  • 9467(Human)
• Uniprot:
  • O60239(Human)