SH3BGRL3 Antibody

Images

 
Western Blot: SH3BGRL3 Antibody [NBP1-89502] - Analysis in human cell line U-87 MG.
Immunohistochemistry-Paraffin: SH3BGRL3 Antibody [NBP1-89502] - Staining of human smooth muscle shows strong cytoplasmic positivity in smooth muscle cells.
Immunohistochemistry-Paraffin: SH3BGRL3 Antibody [NBP1-89502] - Staining of human smooth muscle shows strong cytoplasmic positivity in smooth muscle cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SH3BGRL3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SEVTRILDGKRIQYQLVDISQDNALRDEMRALAGNPKATPPQIVNGDQYCGDYELFVEAVEQNTLQEFLKLA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SH3BGRL3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SH3BGRL3 Protein (NBP1-89502PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SH3BGRL3 Antibody

  • SH3 domain binding glutamic acid-rich protein like 3
  • SH3 domain-binding glutamic acid-rich-like protein 3
  • SH3 domain-binding protein 1
  • SH3BGRL3-like protein
  • SH3BP-1
  • TIP-B1
  • TNF inhibitory protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-33609
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF3119
Species: Mu
Applications: WB
NBP2-38161
Species: Hu
Applications: IHC, IHC-P
AF1970
Species: Hu
Applications: WB, Simple Western, IHC
H00010146-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, RNAi SP
NB500-487
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
NBP1-46170
Species: Hu
Applications: WB, IHC-P, IP
NBP1-19015
Species: Hu, Mu
Applications: WB, Simple Western, ELISA, ICC/IF, IP
NBP1-77836
Species: Hu, Mu, Rt, Po, Bv, Ch, Xp, Ze
Applications: WB, ELISA, Flow, IHC, IHC-P
AF3589
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NBP2-34060
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56343
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, IP
NB110-57586
Species: Hu, Mu, Rt, Bv, Ch, Pm, Rb
Applications: WB, IHC, IHC-P
NB100-56355
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB120-3446
Species: Hu, Mu, Rt, Ha, Rb
Applications: WB, ChIP, GS, ICC/IF, IHC, IHC-P, IP, ICC, IF
NBP1-18910
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-89502
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for SH3BGRL3 Antibody (NBP1-89502) (0)

There are no publications for SH3BGRL3 Antibody (NBP1-89502).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SH3BGRL3 Antibody (NBP1-89502) (0)

There are no reviews for SH3BGRL3 Antibody (NBP1-89502). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SH3BGRL3 Antibody (NBP1-89502) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SH3BGRL3 Products

Bioinformatics Tool for SH3BGRL3 Antibody (NBP1-89502)

Discover related pathways, diseases and genes to SH3BGRL3 Antibody (NBP1-89502). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SH3BGRL3 Antibody (NBP1-89502)

Discover more about diseases related to SH3BGRL3 Antibody (NBP1-89502).
 

Pathways for SH3BGRL3 Antibody (NBP1-89502)

View related products by pathway.

PTMs for SH3BGRL3 Antibody (NBP1-89502)

Learn more about PTMs related to SH3BGRL3 Antibody (NBP1-89502).

Blogs on SH3BGRL3

There are no specific blogs for SH3BGRL3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SH3BGRL3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SH3BGRL3