SGPP1 Antibody

Immunohistochemistry-Paraffin: SGPP1 Antibody [NBP2-13303] - Staining of human skeletal muscle shows very weak cytoplasmic positivity in myocytes.

Immunohistochemistry-Paraffin: SGPP1 Antibody [NBP2-13303] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.

Immunohistochemistry-Paraffin: SGPP1 Antibody [NBP2-13303] - Staining of human placenta shows moderate membranous positivity in decidula cells.

Immunohistochemistry-Paraffin: SGPP1 Antibody [NBP2-13303] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.

Product Discontinued

SGPP1 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KITIPLACKIFNIPCDDIRKARQHMEVELPYR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SGPP1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation/Permeabilization: PFA/Triton X-100

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (84%), Rat (81%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SGPP1 Antibody

• sphingosine-1-phosphate phosphatase 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SGPP1