SGEF Antibody


Western Blot: SGEF Antibody [NBP1-70702] - OVCAR-3 tissue lysate at a concentration of 1ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

SGEF Antibody Summary

Synthetic peptides corresponding to SGEF(Src homology 3 domain-containing guanine nucleotide exchange factor) The peptide sequence was selected from the N terminal of SGEF. Peptide sequence MDGESEVDFSSNSITPLWRRRSIPQPHQVLGRSKPRPQSYQSPNGLLIT
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against SGEF and was validated on Western blot.
Reviewed Applications
Read 1 Review rated 3
NBP1-70702 in the following application:

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SGEF Antibody

  • Rho guanine nucleotide exchange factor (GEF) 26


SGEF activates RhoG GTPase by promoting the exchange of GDP by GTP. SGEF is required for the formation of membrane ruffles during macropinocytosis. SGEF is also required for the formation of cup-like structures during trans-endothelial migration of leukoc


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB
Species: Hu, Mu
Applications: WB, ICC/IF
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, IHC
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Species: Hu
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, ICC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Pm
Applications: WB, IHC, IHC-P
Species: Mu
Species: Hu, Mu, Rt, Ma
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, IHC, Block

Publications for SGEF Antibody (NBP1-70702) (0)

There are no publications for SGEF Antibody (NBP1-70702).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for SGEF Antibody (NBP1-70702) (1) 31

Average Rating: 3
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using NBP1-70702:
Filter by Applications
All Applications
Filter by Species
All Species
Images Ratings Applications Species Date Details
Western Blot SGEF NBP1-70702
reviewed by:
WB Human 05/14/2017


ApplicationWestern Blot
Sample TestedHuman Coronary Artery Smooth Muscle Cells,THP-1 cell lysate,HUVEC whole cell lysate

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SGEF Antibody (NBP1-70702) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional SGEF Products

SGEF NBP1-70702

Bioinformatics Tool for SGEF Antibody (NBP1-70702)

Discover related pathways, diseases and genes to SGEF Antibody (NBP1-70702). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on SGEF

There are no specific blogs for SGEF, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Recent Reviews


Application: WB
Species: Human


Gene Symbol ARHGEF26