SFRS8 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SFSWAP. Source: E. coli
Amino Acid Sequence: VELPPTAKMHAIIERTASFVCRQGAQFEIMLKAKQARNSQFDFLRFDHYLNPYYKFIQKAMKEGRYTVLAENKSDEKKKSGVSSDNEDDDD Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
SFSWAP |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87052. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
28 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for SFRS8 Recombinant Protein Antigen
Background
SFRS8 regulates the splicing of CD45, a protein which through alternative splice variants, has an essential role in activating T cells. T cells are involved in the pathogenesis of atopic diseases such as asthma, making SFRS8 a very interesting candidate gene in the region. SFRS8 could act as a weak predisposing gene for asthma. [from: http://www.ncbi.nlm.nih.gov/sites/entrez®cmd=Retrieve&db=PubMed&list_uids=16738036&dopt=Abstract] The basic functions of SFRS8 are the mediation of protein-protein interactions within the intron during spliceosome assembly, independently binding to exonic enhancer sequences, and recruiting components to adjacent introns for splice-site recognition and alternative splicing. [from: http://www.dsi.univ-paris5.fr/genatlas/fiche1.php®symbol=SFRS8]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: ELISA, Flow, Func, WB
Species: Mu
Applications: ELISA
Species: Mu
Applications: ELISA
Species: Hu
Applications: BA
Species: Mu
Applications: ELISA
Species: Mu
Applications: BA
Species: Hu, Rt
Applications: ICC/IF, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: CHIP-SEQ, Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: IP, WB
Species: Hu
Applications: IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Pm, Mu
Applications: Flow, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: ELISA
Publications for SFRS8 Protein (NBP1-87052PEP) (0)
There are no publications for SFRS8 Protein (NBP1-87052PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for SFRS8 Protein (NBP1-87052PEP) (0)
There are no reviews for SFRS8 Protein (NBP1-87052PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for SFRS8 Protein (NBP1-87052PEP) (0)
Additional SFRS8 Products
Blogs on SFRS8