We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

SFRS8 Recombinant Protein Antigen

Images

 
There are currently no images for SFRS8 Protein (NBP1-87052PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

SFRS8 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SFSWAP.

Source: E. coli

Amino Acid Sequence: VELPPTAKMHAIIERTASFVCRQGAQFEIMLKAKQARNSQFDFLRFDHYLNPYYKFIQKAMKEGRYTVLAENKSDEKKKSGVSSDNEDDDD

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SFSWAP
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87052.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SFRS8 Recombinant Protein Antigen

  • Drosophila homolog)
  • Drosophila)
  • SFRS8
  • splicing factor, arginine/serine-rich 8 (suppressor-of-white-apricot homolog
  • splicing factor, arginine/serine-rich 8 (suppressor-of-white-apricot
  • Splicing factor, arginine/serine-rich 8
  • splicing factor, suppressor of white-apricot homolog (Drosophila)
  • splicing factor, suppressor of white-apricot homolog
  • Suppressor of white apricot protein homolog
  • SWAPMGC167082

Background

SFRS8 regulates the splicing of CD45, a protein which through alternative splice variants, has an essential role in activating T cells. T cells are involved in the pathogenesis of atopic diseases such as asthma, making SFRS8 a very interesting candidate gene in the region. SFRS8 could act as a weak predisposing gene for asthma. [from: http://www.ncbi.nlm.nih.gov/sites/entrez®cmd=Retrieve&db=PubMed&list_uids=16738036&dopt=Abstract] The basic functions of SFRS8 are the mediation of protein-protein interactions within the intron during spliceosome assembly, independently binding to exonic enhancer sequences, and recruiting components to adjacent introns for splice-site recognition and alternative splicing. [from: http://www.dsi.univ-paris5.fr/genatlas/fiche1.php®symbol=SFRS8]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00004068-M01
Species: Hu, Mu
Applications: ELISA, Flow, Func, WB
MPTX20
Species: Mu
Applications: ELISA
DY417
Species: Mu
Applications: ELISA
6507-IL/CF
Species: Hu
Applications: BA
M5000
Species: Mu
Applications: ELISA
485-MI
Species: Mu
Applications: BA
H00005662-B01P
Species: Hu, Rt
Applications: ICC/IF, WB
NBP2-46421
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP1-31851
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP1-86644
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-76393
Species: Hu, Mu
Applications: CHIP-SEQ, Flow, ICC/IF, IHC,  IHC-P, IP, WB
AF6386
Species: Hu
Applications: IP, WB
NBP3-52290
Species: Hu
Applications:  IHC-P, WB
NBP1-86641
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP2-01650
Species: Hu, Pm, Mu
Applications: Flow, IHC,  IHC-P, WB
202-IL
Species: Hu
Applications: BA
NBP2-20324
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-82999
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
DY413
Species: Mu
Applications: ELISA

Publications for SFRS8 Protein (NBP1-87052PEP) (0)

There are no publications for SFRS8 Protein (NBP1-87052PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SFRS8 Protein (NBP1-87052PEP) (0)

There are no reviews for SFRS8 Protein (NBP1-87052PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SFRS8 Protein (NBP1-87052PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SFRS8 Products

Array NBP1-87052PEP

Blogs on SFRS8

There are no specific blogs for SFRS8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SFRS8 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SFSWAP