SFRS12 Antibody

Images

 
Western Blot: SFRS12 Antibody [NBP1-87993] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: SFRS12 Antibody [NBP1-87993] - Staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli, mitochondria and vesicles.
Immunohistochemistry-Paraffin: SFRS12 Antibody [NBP1-87993] - Staining of human pancreas shows moderate nuclear and cytoplasmic positivity in exocrine glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SFRS12 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KQVGEVKFVRMAGDETQPTRFAFVEFADQNSVPRALAFNGVMFGDRPLKINHSNNAIVKPPEMTPQAAAKELEEVMKRV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SREK1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SFRS12 Protein (NBP1-87993PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SFRS12 Antibody

  • DKFZp564B176
  • Serine/arginine-rich-splicing regulatory protein 86
  • SFRS12serine-arginine-rich-splicing regulatory protein 86
  • Splicing factor, arginine/serine-rich 12MGC133045
  • splicing regulatory glutamine/lysine-rich protein 1
  • Splicing regulatory protein 508
  • SRRp508
  • SRrp508SRrp86serine-arginine-rich splicing regulatory protein 508
  • SRRP86

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5745
Species: Hu
Applications: WB, IHC
AF6387
Species: Hu
Applications: WB
H00006428-M08
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-20324
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NB200-191
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-31164
Species: Hu
Applications: WB, ICC/IF
NBP1-97572
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP1-87381
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00010921-M05
Species: Hu
Applications: WB, ELISA, IP
NBP2-22169
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-13380
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02060
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF4094
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
AF5540
Species: Mu
Applications: WB
NB100-2593
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NB100-1774
Species: Hu, Rt, Am, Dr
Applications: WB, EM, ELISA, ICC/IF, IP
NBP1-86191
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for SFRS12 Antibody (NBP1-87993) (0)

There are no publications for SFRS12 Antibody (NBP1-87993).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SFRS12 Antibody (NBP1-87993) (0)

There are no reviews for SFRS12 Antibody (NBP1-87993). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SFRS12 Antibody (NBP1-87993) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SFRS12 Products

Bioinformatics Tool for SFRS12 Antibody (NBP1-87993)

Discover related pathways, diseases and genes to SFRS12 Antibody (NBP1-87993). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SFRS12 Antibody (NBP1-87993)

Discover more about diseases related to SFRS12 Antibody (NBP1-87993).
 

Pathways for SFRS12 Antibody (NBP1-87993)

View related products by pathway.

Blogs on SFRS12

There are no specific blogs for SFRS12, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SFRS12 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SREK1