SFRS12 Antibody - BSA Free

Immunohistochemistry-Paraffin: SFRS12 Antibody [NBP1-87993] - Staining of human cerebral cortex, liver, small intestine and testis using Anti-SREK1 antibody NBP1-87993 (A) shows similar protein distribution across tissues to independent antibody NBP2-57236 (B).

Immunohistochemistry-Paraffin: SFRS12 Antibody [NBP1-87993] - Staining in human testis and skeletal muscle tissues using anti-SREK1 antibody. Corresponding SREK1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: SFRS12 Antibody [NBP1-87993] - Staining of human testis shows high expression.

Immunohistochemistry-Paraffin: SFRS12 Antibody [NBP1-87993] - Staining of human skeletal muscle shows low expression as expected.

Immunohistochemistry-Paraffin: SFRS12 Antibody [NBP1-87993] - Staining of human liver.

Immunohistochemistry-Paraffin: SFRS12 Antibody [NBP1-87993] - Staining of human small intestine.

Immunohistochemistry-Paraffin: SFRS12 Antibody [NBP1-87993] - Staining of human cerebral cortex.

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SFRS12 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SFRS12 Antibody - BSA Free (NBP1-87993) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KQVGEVKFVRMAGDETQPTRFAFVEFADQNSVPRALAFNGVMFGDRPLKINHSNNAIVKPPEMTPQAAAKELEEVMKRV
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SREK1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  SFRS12 Protein (NBP1-87993PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SFRS12 Antibody - BSA Free

• DKFZp564B176
• Serine/arginine-rich-splicing regulatory protein 86
• SFRS12serine-arginine-rich-splicing regulatory protein 86
• Splicing factor, arginine/serine-rich 12MGC133045
• splicing regulatory glutamine/lysine-rich protein 1
• Splicing regulatory protein 508
• SRRp508
• SRrp508SRrp86serine-arginine-rich splicing regulatory protein 508
• SRRP86

Background

SFRS12 belongs to the superfamily of serine/arginine-rich (SR) splicing factors. It modulates splice site selection by regulating the activities of other SR proteins (Barnard et al., 2002 [PubMed 11991645]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SREK1