SFPQ Antibody (3B10) - Azide and BSA Free

Western Blot: SFPQ Antibody (3B10) [H00006421-M01] - SFPQ monoclonal antibody (M01), clone 3B10. Analysis of SFPQ expression in Hela S3 NE.

Immunocytochemistry/Immunofluorescence: SFPQ Antibody (3B10) [H00006421-M01] - Analysis of monoclonal antibody to SFPQ on HeLa cell . Antibody concentration 10 ug/ml.

Sandwich ELISA: SFPQ Antibody (3B10) [H00006421-M01] - Detection limit for recombinant GST tagged SFPQ is approximately 0.3ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, ICC/IF
• Clone: 3B10
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

SFPQ Antibody (3B10) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: SFPQ (NP_005057, 269 a.a. ~ 361 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EEKISDSEGFKANLSLLRRPGEKTYTQRCRLFVGNLPADITEDEFKRLFAKYGEPGEVFINKGKGFGFIKLESRALAEIAKAELDDTPMRGRQ
• Specificity: SFPQ - splicing factor proline/glutamine-rich (polypyrimidine tract binding protein associated) (3B10)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: SFPQ
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Sandwich ELISA
  • Western Blot
• Application Notes: Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SFPQ Antibody (3B10) - Azide and BSA Free

• 100 kDa DNA-pairing protein
• DNA-binding p52/p100 complex, 100 kDa subunit
• hPOMp100
• polypyrimidine tract binding protein associated
• polypyrimidine tract-binding protein-associated splicing factor
• Polypyrimidine tract-binding protein-associated-splicing factor
• PSFPOMP100
• PTB-associated splicing factor
• PTB-associated-splicing factor
• splicing factor proline/glutamine rich (polypyrimidine tract binding proteinassociated)
• splicing factor proline/glutamine rich (polypyrimidine tract-bindingprotein-associated)
• splicing factor proline/glutamine-rich
• splicing factor, proline- and glutamine-rich

Background

PSF/SFPQ is a multifunctional protein know to participate in a variety of nuclear processes and may function to link transcription and pre-mRNA processing. PSF/SFPQ bears an RNA recognition motif (RRM) further indicating its role in post-transcriptional processes. PSF has been shown to associate with p54nrb/NonO to modulate androgen receptor-mediated transcription. Additionally, it has recently been show to associate with XRN2 and p54nrb/NonO to facilitate pre-mRNA 3' processing and transcription termination. Alternate names for PSF/SFPQ include polypyrimidine tract-binding protein-associated-splicing factor, PTB-associated-splicing factor, splicing factor proline-and glutamine-rich, and POMP100.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SFPQ
• Entrez:
  • 6421(Human)
• Uniprot:
  • NP_005057(Human)