SF4 Antibody


Western Blot: SF4 Antibody [NBP1-57563] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity Hu, Mu, Rt, Bv, Ca, Eq, GP, Ye, ZeSpecies Glossary
Applications WB

Order Details

SF4 Antibody Summary

Synthetic peptides corresponding to SF4(splicing factor 4) The peptide sequence was selected from the N terminal of SF4. Peptide sequence MSLKMDNRDVAGKANRWFGVAPPKSGKMNMNILHQEELIAQKKREIEAKM.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against SF4 and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SF4 Antibody

  • DKFZp434E2216
  • F23858
  • SF4RNA-binding protein RBP
  • Splicing factor 4RBP
  • SURP and G patch domain containing 1
  • SURP and G-patch domain-containing protein 1


SF4 is a member of the SURP family of splicing factors.SF4 is a member of the SURP family of splicing factors.[supplied by OMIM].


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
Species: Hu, Po, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, RIA, B/N
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
Species: Hu
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Rt, Bv, Ca, Ch, Fe, Pm, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Pm
Applications: Flow, IHC, IHC-P, IP, Flow-CS
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Ye, Ze
Applications: WB

Publications for SF4 Antibody (NBP1-57563) (0)

There are no publications for SF4 Antibody (NBP1-57563).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SF4 Antibody (NBP1-57563) (0)

There are no reviews for SF4 Antibody (NBP1-57563). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SF4 Antibody (NBP1-57563) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional SF4 Products

Array NBP1-57563

Bioinformatics Tool for SF4 Antibody (NBP1-57563)

Discover related pathways, diseases and genes to SF4 Antibody (NBP1-57563). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on SF4

There are no specific blogs for SF4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SF4 Antibody and receive a gift card or discount.


Gene Symbol SUGP1