SF3B5 Recombinant Protein Antigen

Images

 
There are currently no images for SF3B5 Protein (NBP2-13301PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

SF3B5 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SF3B5.

Source: E.coli

Amino Acid Sequence: DRYTIHSQLEHLQSKYIGTGHADTTKWEWLVNQHRDSYCSYMGHFDLLNYFAIAENESKARVRFNLMEKMLQPCGPPADKPEEN

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SF3B5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-13301.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for SF3B5 Recombinant Protein Antigen

  • MGC3133
  • Pre-mRNA-splicing factor SF3b 10 kDa subunit
  • SF3b10
  • SF3b5
  • splicing factor 3B subunit 5
  • splicing factor 3b, subunit 5, 10kDa
  • Ysf3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-92692
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NB100-79848
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-91776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13785
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-53181
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-20403
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-13923
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-75656
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-13920
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-1077
Species: Hu
Applications: WB, PEP-ELISA
NBP1-81800
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-85269
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82454
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88591
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NB100-79843
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, ChIP
NBP2-49381
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-71687
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-84010
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47281
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for SF3B5 Protein (NBP2-13301PEP) (0)

There are no publications for SF3B5 Protein (NBP2-13301PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SF3B5 Protein (NBP2-13301PEP) (0)

There are no reviews for SF3B5 Protein (NBP2-13301PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for SF3B5 Protein (NBP2-13301PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for SF3B5 Protein (NBP2-13301PEP)

Discover related pathways, diseases and genes to SF3B5 Protein (NBP2-13301PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on SF3B5

There are no specific blogs for SF3B5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

p19ARF Antibody
NB200-106
SF3B5 Antibody
NBP2-13301
SF3A1 Antibody
NB100-79843

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SF3B5 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SF3B5