SF3B2 Antibody - BSA Free

Immunohistochemistry: SF3B2 Antibody [NBP3-38205] - Immunohistochemistry analysis of paraffin-embedded Human lung cancer using SF3B2 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Western Blot: SF3B2 Antibody [NBP3-38205] - Western blot analysis of various lysates using SF3B2 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 5s.

Immunohistochemistry: SF3B2 Antibody [NBP3-38205] - Immunohistochemistry analysis of paraffin-embedded Rat heart using SF3B2 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Immunohistochemistry: SF3B2 Antibody [NBP3-38205] - Immunohistochemistry analysis of paraffin-embedded Mouse Intestine using SF3B2 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Immunocytochemistry/ Immunofluorescence: SF3B2 Antibody [NBP3-38205] - Immunofluorescence analysis of A-549 cells using SF3B2 Rabbit pAb.Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SF3B2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SF3B2 Antibody - BSA Free (NBP3-38205) is a polyclonal antibody validated for use in IHC, WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 616-895 of human SF3B2 (NP_006833.2).
  
  Sequence:
  SLGMPVGPNAHKVPPPWLIAMQRYGPPPSYPNLKIPGLNSPIPESCSFGYHAGGWGKPPVDETGKPLYGDVFGTNAAEFQTKTEEEEIDRTPWGELEPSDEESSEEEEEEESDEDKPDETGFITPADSGLITPGGFSSVPAGMETPELIELRKKKIEEAMDGSETPQLFTVLPEKRTATVGGAMMGSTHIYDMSTVMSRKGPAPELQGVEVALAPEELELDPMAMTQKYEEHVREQQAQVEKEDFSDMVAEHAAKQKQKKRKAQPQDSRGGSKKYKEFKF
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SF3B2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 100 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for SF3B2 Antibody - BSA Free

• Cus1
• pre-mRNA splicing factor SF3b 145 kDa subunit
• Pre-mRNA-splicing factor SF3b 145 kDa subunit
• SAP145SAP 145
• SF3b1
• SF3B145
• SF3b150
• spliceosome associated protein 145
• Spliceosome-associated protein 145
• splicing factor 3B subunit 2
• splicing factor 3b, subunit 2, 145kD
• splicing factor 3b, subunit 2, 145kDa

Background

SF3B2 encodes subunit 2 of the splicing factor 3b protein complex. Splicing factor 3b, together with splicing factor 3a and a 12S RNA unit, forms the U2 small nuclear ribonucleoproteins complex (U2 snRNP). The splicing factor 3b/3a complex binds pre-mRNA upstream of the intron's branch site in a sequence-independent manner and may anchor the U2 snRNP to the pre-mRNA. Splicing factor 3b is also a component of the minor U12-type spliceosome. Subunit 2 associates with pre-mRNA upstream of the branch site at the anchoring site. Subunit 2 also interacts directly with subunit 4 of the splicing factor 3b complex. Subunit 2 is a highly hydrophilic protein with a proline-rich N-terminus and a glutamate-rich stretch in the C-terminus.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SF3B2