SF3B2 Antibody - BSA Free

Western Blot: SF3B2 Antibody [NBP1-92380] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented.

Immunocytochemistry/Immunofluorescence: SF3B2 Antibody [NBP1-92380] - Immunofluorescent staining of human cell line U-2 OS shows localization to nuclear speckles.

Immunohistochemistry-Paraffin: SF3B2 Antibody [NBP1-92380] - Staining of human colon shows strong nuclear positivity in glandular cells.

Staining of human cerebral cortex shows strong nuclear positivity in neuronal cells.

Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.

Staining of human cervix, uterine shows strong nuclear positivity in squamous epithelial cells.

Staining of human cell line U-2 OS shows localization to nuclear speckles.

Staining of human colon shows strong nuclear positivity in glandular cells.

Analysis in human cell line SH-SY5Y.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, KD
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SF3B2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MSTVMSRKGPAPELQGVEVALAPEELELDPMAMTQKYEEHVREQQAQVEKEDFSDMVAEHAAKQKQKKRKAQPQDSRGGSKKYKEFK
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SF3B2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  SF3B2 Protein (NBP1-92380PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SF3B2 Antibody - BSA Free

• Cus1
• pre-mRNA splicing factor SF3b 145 kDa subunit
• Pre-mRNA-splicing factor SF3b 145 kDa subunit
• SAP145SAP 145
• SF3b1
• SF3B145
• SF3b150
• spliceosome associated protein 145
• Spliceosome-associated protein 145
• splicing factor 3B subunit 2
• splicing factor 3b, subunit 2, 145kD
• splicing factor 3b, subunit 2, 145kDa

Background

SF3B2 encodes subunit 2 of the splicing factor 3b protein complex. Splicing factor 3b, together with splicing factor 3a and a 12S RNA unit, forms the U2 small nuclear ribonucleoproteins complex (U2 snRNP). The splicing factor 3b/3a complex binds pre-mRNA upstream of the intron's branch site in a sequence-independent manner and may anchor the U2 snRNP to the pre-mRNA. Splicing factor 3b is also a component of the minor U12-type spliceosome. Subunit 2 associates with pre-mRNA upstream of the branch site at the anchoring site. Subunit 2 also interacts directly with subunit 4 of the splicing factor 3b complex. Subunit 2 is a highly hydrophilic protein with a proline-rich N-terminus and a glutamate-rich stretch in the C-terminus.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SF3B2 Antibody (NBP1-92380)(1)

Publication using NBP1-92380

• Yang G, Xiang J, Yang X et al. Nuclear translocation of SIRT4 mediates deacetylation of U2AF2 to modulate renal fibrosis through alternative splicing-mediated upregulation of CCN2 eLife 2024-11-04 [PMID: 39495216]

Bioinformatics

• Gene Symbol: SF3B2