SF3A3 Antibody

Images

 
Western Blot: SF3A3 Antibody [NBP1-87212] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-518
Immunocytochemistry/ Immunofluorescence: SF3A3 Antibody [NBP1-87212] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: SF3A3 Antibody [NBP1-87212] - Staining of human fallopian tube shows strong nuclear positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, Rt, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SF3A3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TKKSTLRDQINSDHRTRAMQDRYMEVSGNLRDLYDDKDGLRKEELNAISGPNEFAEFYNRLKQIKEFHRKHPNEICVPMSVEFE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SF3A3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SF3A3 Protein (NBP1-87212PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SF3A3 Antibody

  • PRP9
  • PRPF9
  • SAP 61
  • SAP61splicing factor 3a, subunit 3, 60kD
  • SF3a60pre-mRNA splicing factor SF3a (60kD)
  • spliceosome associated protein 61
  • Spliceosome-associated protein 61
  • splicing factor 3A subunit 3
  • splicing factor 3a, subunit 3, 60kDa

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-79843
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, ChIP
H00008175-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP2-58751
Species: Hu
Applications: WB, ICC/IF
NBP1-92298
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56605
Species: Av, Bv, Sh
Applications: WB
H00079092-T01
Species: Hu
H00007001-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-88263
Species: Hu
Applications: WB, IHC, IHC-P
MAB8209
Species: Hu, Mu, Rt
Applications: WB, ICC
NB100-1607
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38755
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-19120
Species: Hu, Mu
Applications: WB, IHC-P, IP
H00023435-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-82859
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-30888
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83565
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-87212
Species: Hu, Mu, Rt, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for SF3A3 Antibody (NBP1-87212) (0)

There are no publications for SF3A3 Antibody (NBP1-87212).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SF3A3 Antibody (NBP1-87212) (0)

There are no reviews for SF3A3 Antibody (NBP1-87212). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SF3A3 Antibody (NBP1-87212) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SF3A3 Products

Bioinformatics Tool for SF3A3 Antibody (NBP1-87212)

Discover related pathways, diseases and genes to SF3A3 Antibody (NBP1-87212). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SF3A3 Antibody (NBP1-87212)

Discover more about diseases related to SF3A3 Antibody (NBP1-87212).
 

Pathways for SF3A3 Antibody (NBP1-87212)

View related products by pathway.

PTMs for SF3A3 Antibody (NBP1-87212)

Learn more about PTMs related to SF3A3 Antibody (NBP1-87212).

Blogs on SF3A3

There are no specific blogs for SF3A3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SF3A3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SF3A3