PWP1 Antibody (3A11)

Images

 
Western Blot: PWP1 Antibody (3A11) [H00011137-M01] - Analysis of PWP1 expression in transfected 293T cell line by PWP1 monoclonal antibody (M01), clone 3A11.Lane 1: PWP1 transfected lysate (Predicted MW: 55.9 KDa).Lane ...read more
Immunocytochemistry/ Immunofluorescence: PWP1 Antibody (3A11) [H00011137-M01] - Analysis of monoclonal antibody to PWP1 on HeLa cell. Antibody concentration 10 ug/ml.
Sandwich ELISA: PWP1 Antibody (3A11) [H00011137-M01] - Detection limit for recombinant GST tagged PWP1 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
3A11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

PWP1 Antibody (3A11) Summary

Immunogen
PWP1 (AAH01652, 1 a.a. ~ 502 a.a) full length recombinant protein with GST tag.MNRSRQVTCVAWVRCGVAKETPDKVELSKEEVKRLIAEAKEK LQEEGGGSDEEETGSPSEDGMQSARTQARPREPLEDGDPEDD RTLDDDELAEYDLDKYDEEGDPDAETLGESLLGLTVYGSNDQ DPYVTLKDTEQYEREDFLIKPSDNLIVCGRAEQDQCNLDVHV YNQEEDSFYVHHDILLSAYPLSVEWLNFDPSPDDSTGNYIAV GNMTPVIEVWDLDIVDSLEPVFTLGSKLSKKKKKK
Localization
Nuclear
Specificity
PWP1 - PWP1 homolog (S. cerevisiae)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PWP1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactive against recombinant protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PWP1 Antibody (3A11)

  • IEF-SSP-9502
  • Keratinocyte protein IEF SSP 9502
  • nuclear phosphoprotein similar to S. cerevisiae PWP1
  • periodic tryptophan protein 1 homolog
  • PWP1 homolog (S. cerevisiae)

Background

PWP1 belongs to the WD repeat PWP1 family. It may play an important role in cell growth and/or transcription.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87212
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38016
Species: Hu
Applications: WB, IHC, IHC-P
H00023435-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
MAB8209
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-82859
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-30888
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1607
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33002
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-82547
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-19120
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP2-29940
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC-P
NBP2-19926
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90029
Species: Hu
Applications: WB, IHC, IHC-P
MAB362
Species: Hu
Applications: Flow, CyTOF-ready
NBL1-11569
Species: Hu
AF3764
Species: Hu, Mu
Applications: WB, IHC, ICC
NB21-2024
Species: Hu, Mu, Rt, Ma
Applications: WB, ChIP, DB, ICC/IF
H00011137-M01
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for PWP1 Antibody (H00011137-M01) (0)

There are no publications for PWP1 Antibody (H00011137-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PWP1 Antibody (H00011137-M01) (0)

There are no reviews for PWP1 Antibody (H00011137-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PWP1 Antibody (H00011137-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PWP1 Products

Bioinformatics Tool for PWP1 Antibody (H00011137-M01)

Discover related pathways, diseases and genes to PWP1 Antibody (H00011137-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PWP1 Antibody (H00011137-M01)

Discover more about diseases related to PWP1 Antibody (H00011137-M01).
 

Pathways for PWP1 Antibody (H00011137-M01)

View related products by pathway.

PTMs for PWP1 Antibody (H00011137-M01)

Learn more about PTMs related to PWP1 Antibody (H00011137-M01).

Blogs on PWP1

There are no specific blogs for PWP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PWP1 Antibody (3A11) and receive a gift card or discount.

Bioinformatics

Gene Symbol PWP1
Entrez
Uniprot