SF20/MYDGF Antibody - BSA Free

Western Blot: SF20/MYDGF Antibody [NBP1-98494] - Titration: 1.0 ug/ml Positive Control: MCF7 Whole Cell.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

SF20/MYDGF Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: The immunogen for this antibody is a synthetic peptide, corresponding to aa 19-68, from the N-terminal region of SF20/MYDGF (NP_061980). Peptide sequence LLLGAVALRPAEAVSEPTTVAFDVRPGGVVHSFSHNVGPGDKYTCMFTYA. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MYDGF
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 19 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for SF20/MYDGF Antibody - BSA Free

• C19orf10
• chromosome 19 open reading frame 10
• EUROIMAGE1875335
• IL25
• IL27
• IL27w
• interleukin 27 working designation
• interleukin-25
• Ly6elg
• MYDGF
• myeloid-derived growth factor
• R33729_1
• SF20
• Stromal cell-derived growth factor SF20
• UPF0556 protein C19orf10

Background

Myeloid-Derived Growth Factor, or MYDGF, is a Bone marrow-derived monocyte protein, and it is correlated with enhanced metabolic activity, suppression of apoptosis, and stimulation of cell proliferation (1). MYDGF is expressed predominantly in inflammatory cells, such as monocytes and macrophages (1). Up-regulation of MYDGF expression was also found during adipocyte differentiation (2). Expression of MYDGF was induced in the circulation and heart tissue after myocardial infarction. It promotes cardiac myocyte survival by stimulating endothelial cell proliferation through a MAPK1/3-, STAT3- and CCND1-mediated signaling pathway, and inhibits cardiac myocyte apoptosis in a PI3K/AKT-dependent signaling pathway (1). MYDGF was found over-expressed in approximately two-thirds of Hepatocellular Carcinoma (HCC) tissues, and its expression was significantly positively correlated with that of alpha-fetoprotein (AFP) (3). In HCC, MYDGF could regulate cell proliferation through activating Akt/mitogen-activated protein kinase pathways (3). Mouse MYDGF shares 92% amino acid sequence identity with both human and rat MYDGF. Intriguingly, virtually all homologs of MYDGF have a C-terminal putative ER retention sequence BXEL (B: Arg, His, or Lys; X: variable residue; E: Glu; L: Leu), which has the potential to retain human MYDGF and its homologs in the ER, whereas truncated MYDGF without BXEL is secreted from the cell (4). However, the functions of these different forms remain unclear.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MYDGF
• Entrez:
  • 56005(Human)
• Uniprot:
  • Q969H8()