SETMAR Antibody

Images

 
Western Blot: SETMAR Antibody [H00006419-B01P] - Analysis of SETMAR expression in human kidney.
Western Blot: SETMAR Antibody [H00006419-B01P] - Analysis of SETMAR expression in transfected 293T cell line by SETMAR polyclonal antibody. Lane 1: SETMAR transfected lysate(38.72 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

SETMAR Antibody Summary

Immunogen
SETMAR (AAH11635.1, 1 a.a. - 352 a.a.) full-length human protein. MAEFKEKPEAPTEQLDVACGQENLPVGAWPPGAAPAPFQYTPDHVVGPGADIDPTQITFPGCICVKTPCLPGTCSCLRHGENYDDNSCLRDIGSGGKYAEPVFECNVLCRCSDHCRNRVVQKGLQFHFQVFKTHKKGWGLRTLEFIPKGRFVCEYAGEVLGFSEVQRRIHLQTKSDSNYIIAIREHVYNGQVMETFVDPTYIGNIGRFLNHSCEPNLLMIPVRIDSMVPKLALFAAKDIVPEEELSYDYSGRYLNLTVSEDKERLDHGKLRKPCYCGAKSCTAFLPFDSSLYCPVEKSNISCGNEKEPSMCGSAPSVFPSCKRLTLEVSLFSDKQLAPPYSGRQWLASFTSA
Specificity
SETMAR - SET domain and mariner transposase fusion gene,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
SETMAR
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.
Publications
Read Publication using H00006419-B01P.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SETMAR Antibody

  • EC 2.1.1.43
  • histone-lysine N-methyltransferase SETMAR
  • hsMar1
  • METNASE
  • SET domain and mariner transposase fusion gene
  • SET domain and mariner transposase fusion gene-containing protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-30141
Species: Hu, Mu, Rt, Po, Ce, Dr, In, Ma, Ye
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-67597
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB110-57379
Species: Hu, Mu
Applications: WB, IHC, IHC-P, KD
NBP1-30888
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF2288
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Mar, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NB100-464
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NB100-81657
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, ChIP
NBP1-84999
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-31371
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB120-13600
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-143
Species: Hu, Mu, Ha, Ma, Pm
Applications: WB, ChIP, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP, ISH, PAGE, KO
NB100-56155
Species: Hu
Applications: WB, IHC, IHC-P, IP
NB100-148
Species: Hu, Mu, Rt, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, PLA, KD
NBP3-05267
Species: Hu, Mu
Applications: WB
NB100-79784
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NBP1-78305
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-304
Species: Hu, Mu, Rt, Bt, Bv, Ca, Fi, Gt, Pm
Applications: WB, ChIP, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ISH, Flow-IC, KD, KO
NBP2-38954
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00006419-B01P
Species: Hu
Applications: WB

Publications for SETMAR Antibody (H00006419-B01P)(1)

Reviews for SETMAR Antibody (H00006419-B01P) (0)

There are no reviews for SETMAR Antibody (H00006419-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SETMAR Antibody (H00006419-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SETMAR Products

Bioinformatics Tool for SETMAR Antibody (H00006419-B01P)

Discover related pathways, diseases and genes to SETMAR Antibody (H00006419-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SETMAR Antibody (H00006419-B01P)

Discover more about diseases related to SETMAR Antibody (H00006419-B01P).
 

Pathways for SETMAR Antibody (H00006419-B01P)

View related products by pathway.

PTMs for SETMAR Antibody (H00006419-B01P)

Learn more about PTMs related to SETMAR Antibody (H00006419-B01P).

Blogs on SETMAR

There are no specific blogs for SETMAR, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SETMAR Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SETMAR
Entrez
Uniprot