SETD8 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SETD8 Antibody [NBP2-55772] - Staining of human cell line U-2 OS shows localization to nucleus.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SETD8 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: KDARKGPLVPFPNQKSEAAEPPKTPPSSCDSTNAAIAKQALKKPIKGKQAPRKKAQGKTQQNRKLTDFYPVRRSSRKSKAELQSEERKRIDELIESGK
Specificity
Specificity of human SETD8 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KMT5A
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SETD8 Recombinant Protein Antigen (NBP2-55772PEP)

Reactivity Notes

Rat 88%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for SETD8 Antibody

  • H4-K20-HMTase SETD8
  • H4K20-specific histone methyltransferase splice variant Set8b
  • Histone-lysine N-methyltransferase SETD8
  • KMT5A SET domain-containing protein 8
  • KMT5A
  • Lysine N-methyltransferase 5A
  • PR/SET domain containing protein 8
  • PR/SET domain-containing protein 07
  • PR/SET07
  • PRSET7
  • PR-Set7EC 2.1.1.43
  • SET domain containing (lysine methyltransferase) 8
  • SET07SET8H4-K20-specific histone methyltransferase
  • SET8

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-07996
Species: Hu
NBP2-52486
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NB21-2024
Species: Hu, Mu, Rt, Po, Ma
Applications: WB, ChIP, DB, ICC/IF
H00008365-M01
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA
NBL1-11567
Species: Hu
NB100-40840
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
MAB1207
Species: Hu
Applications: WB, Flow, CyTOF-ready
NB100-56664
Species: Hu, Mu
Applications: WB, ChIP, IHC, IHC-P
NB100-304
Species: Hu, Mu, Rt, Bt, Bv, Ca, Fi, Gt, Pm
Applications: WB, ChIP, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ISH, Flow-IC, KD, KO
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-31361
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
MAB4457
Species: Hu, Mu, Rt
Applications: WB
NBP2-55772
Species: Hu, Mu
Applications: ICC/IF

Publications for SETD8 Antibody (NBP2-55772) (0)

There are no publications for SETD8 Antibody (NBP2-55772).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SETD8 Antibody (NBP2-55772) (0)

There are no reviews for SETD8 Antibody (NBP2-55772). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SETD8 Antibody (NBP2-55772) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SETD8 Products

Bioinformatics Tool for SETD8 Antibody (NBP2-55772)

Discover related pathways, diseases and genes to SETD8 Antibody (NBP2-55772). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SETD8 Antibody (NBP2-55772)

Discover more about diseases related to SETD8 Antibody (NBP2-55772).
 

Pathways for SETD8 Antibody (NBP2-55772)

View related products by pathway.

PTMs for SETD8 Antibody (NBP2-55772)

Learn more about PTMs related to SETD8 Antibody (NBP2-55772).
 

Research Areas for SETD8 Antibody (NBP2-55772)

Find related products by research area.

Blogs on SETD8

There are no specific blogs for SETD8, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SETD8 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KMT5A