Serum Response Factor SRF Recombinant Protein Antigen

Images

 
There are currently no images for Serum Response Factor SRF Protein (NBP1-87814PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Serum Response Factor SRF Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SRF.

Source: E. coli

Amino Acid Sequence: LPTSFTLMPGGAVAQQVPVQAIQVHQAPQQASPSRDSSTDLTQTSSSGTVTLPATIMTSSVPTTVGGHMMYPSPHAVMYAPTSGLGDGSLTVLNAFSQAPSTMQVSHSQVQEPGGVPQVFLTASSGTVQ

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SRF
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87814.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Serum Response Factor SRF Recombinant Protein Antigen

  • MCM1
  • serum response factor (c-fos serum response element-binding transcriptionfactor)
  • Serum Response Factor SRF
  • serum response factor
  • SRF

Background

Serum response factor (SRF) is a transcription factor that binds the serum response element (SRE), a sequence that mediates the transient response of many cellular genes to growth stimulation. SRF is a cardiac-enriched transcription factor that is required for the appearance of beating sarcomeres in the heart. In addition, SRF may also direct the expression of microRNAs that inhibit the expression of cardiac regulatory factors. SRF binding sites are also constitutive promotor elements in many muscle specific promoters. At the c-Fos SRE, formation of a ternary complex containing SRF and its accessory protein p62TCF appears to be important for signal transduction. Two related Ets domain proteins, Elk 1 and SRF accessory protein 1 (SAP 1) have DNA binding properties identical to that of p62TCF

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
NBP1-88498
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
AF2818
Species: Hu
Applications: ICC, WB
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-38278
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
DYC1825-2
Species: Hu, Mu, Rt
Applications: ELISA
NBP3-17510
Species: Hu
Applications: IHC,  IHC-P
NBP2-38278
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NB100-91273
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-25160
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
NBP1-58359
Species: Hu
Applications: IHC,  IHC-P, WB
NB600-507
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, KD, PEP-ELISA, WB
PP-K9218-00
Species: Hu
Applications: IHC, IP, WB
H00004205-M02
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, S-ELISA, WB
DYC2510-2
Species: Hu, Mu, Rt
Applications: ELISA
AF467
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
NBP1-87092
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P, WB
NBP1-87814PEP
Species: Hu
Applications: AC

Publications for Serum Response Factor SRF Protein (NBP1-87814PEP) (0)

There are no publications for Serum Response Factor SRF Protein (NBP1-87814PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Serum Response Factor SRF Protein (NBP1-87814PEP) (0)

There are no reviews for Serum Response Factor SRF Protein (NBP1-87814PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Serum Response Factor SRF Protein (NBP1-87814PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Serum Response Factor SRF Products

Research Areas for Serum Response Factor SRF Protein (NBP1-87814PEP)

Find related products by research area.

Blogs on Serum Response Factor SRF

There are no specific blogs for Serum Response Factor SRF, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Serum Response Factor SRF Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SRF