Serum Amyloid A4 Antibody

Images

 
Immunohistochemistry-Paraffin: Serum Amyloid A4 Antibody [NBP2-32517] - Staining of human kidney shows strong luminal membranous positivity in cells in tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Serum Amyloid A4 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: FKEALQGVGDMGRAYWDIMISNHQNSNRYLYARGNYDAA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SAA4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Serum Amyloid A4 Recombinant Protein Antigen (NBP2-32517PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Serum Amyloid A4 Antibody

  • C-SAA
  • C-SAACSAAConstitutively expressed serum amyloid A protein
  • SAA4
  • SAA5
  • serum amyloid A-4 protein
  • Serum Amyloid A4
  • serum amyloid A4, constitutive

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2948
Species: Mu
Applications: WB, Simple Western, IHC
8478-SA
Species: Mu
NBP2-43581
Species: Hu
Applications: WB, ICC/IF, IP
NBP2-52979
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP1-85786
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-54724
Species: Hu
Applications: WB, IHC-P
NBP2-02710
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00002678-M01
Species: Hu, Mu
Applications: WB, ELISA, IHC-P, IP
NBP1-22439
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-34390
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NBP2-15128
Species: Hu
Applications: WB, IHC, IHC-P
AF5739
Species: Hu, Mu, Rt
Applications: WB
H00152503-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for Serum Amyloid A4 Antibody (NBP2-32517) (0)

There are no publications for Serum Amyloid A4 Antibody (NBP2-32517).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Serum Amyloid A4 Antibody (NBP2-32517) (0)

There are no reviews for Serum Amyloid A4 Antibody (NBP2-32517). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Serum Amyloid A4 Antibody (NBP2-32517) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Serum Amyloid A4 Products

Bioinformatics Tool for Serum Amyloid A4 Antibody (NBP2-32517)

Discover related pathways, diseases and genes to Serum Amyloid A4 Antibody (NBP2-32517). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Serum Amyloid A4 Antibody (NBP2-32517)

Discover more about diseases related to Serum Amyloid A4 Antibody (NBP2-32517).
 

Pathways for Serum Amyloid A4 Antibody (NBP2-32517)

View related products by pathway.

PTMs for Serum Amyloid A4 Antibody (NBP2-32517)

Learn more about PTMs related to Serum Amyloid A4 Antibody (NBP2-32517).

Blogs on Serum Amyloid A4

There are no specific blogs for Serum Amyloid A4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Serum Amyloid A4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SAA4
Entrez