Serpin B3/SCCA1 Antibody (2F5)

Images

 
Western Blot: Serpin B3/SCCA1 Antibody (2F5) [H00006317-M01] - Analysis of SERPINB3 expression in transfected 293T cell line by SERPINB3 monoclonal antibody (M01), clone 2F5.Lane 1: SERPINB3 transfected lysate(44.6 ...read more
Immunoprecipitation: Serpin B3/SCCA1 Antibody (2F5) [H00006317-M01] - Analysis of SERPINB3 transfected lysate using anti-SERPINB3 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with SERPINB3 MaxPab ...read more
ELISA: Serpin B3/SCCA1 Antibody (2F5) [H00006317-M01] - Detection limit for recombinant GST tagged SERPINB3 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IP
Clone
2F5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Serpin B3/SCCA1 Antibody (2F5) Summary

Immunogen
SERPINB3 (NP_008850 276 a.a. - 390 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RETRVDLHLPRFKVEESYDLKDTLRTMGMVDIFNGDADLSGMTGSRGLVLSGVLHKAFVEVTEEGAEAAAATAVVGFGSSPTSTNEEFHCNHPFLFFIRQNKTNSILFYGRFSSP
Specificity
SERPINB3 - serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 3
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SERPINB3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunoprecipitation
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
Publications
Read Publication using
H00006317-M01 in the following applications:

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Serpin B3/SCCA1 Antibody (2F5)

  • HsT1196
  • Protein T4-A
  • SCC
  • SCCA
  • SCCA1
  • SCCA1SCCA-1
  • SCCA-PD
  • serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 3
  • Serpin B3
  • serpin peptidase inhibitor, clade B (ovalbumin), member 3
  • Squamous cell carcinoma antigen 1
  • T4-A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
MAB41281
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
AF4478
Species: Hu
Applications: WB, IHC
H00005670-Q01
Species: Hu
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-03595
Species: Hu
Applications: WB, IHC, IHC-P
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP1-78278
Species: Hu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB110-58870
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC
NBP1-89296
Species: Hu
Applications: WB, IHC, IHC-P
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP2-27461
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
AF1916
Species: Hu
Applications: WB, IHC, ICC
NBP2-24695
Species: Hu
Applications: WB, IHC-P
H00006317-M01
Species: Hu
Applications: WB, ELISA, IP

Publications for Serpin B3/SCCA1 Antibody (H00006317-M01)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: ELISA.


Filter By Application
ELISA
(1)
All Applications
Filter By Species
Human
(1)
All Species
Showing Publication 1 - 1 of 1.
Publication using H00006317-M01 Applications Species
Carrara S, Bhalla V, Stagni C et al. Label-Free Cancer Markers Detection by Capacitance Biochip. Sensors and Actuators B: Chemical 2008 Oct 15 (ELISA, Human) ELISA Human

Reviews for Serpin B3/SCCA1 Antibody (H00006317-M01) (0)

There are no reviews for Serpin B3/SCCA1 Antibody (H00006317-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Serpin B3/SCCA1 Antibody (H00006317-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Serpin B3/SCCA1 Antibody (H00006317-M01)

Discover related pathways, diseases and genes to Serpin B3/SCCA1 Antibody (H00006317-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Serpin B3/SCCA1 Antibody (H00006317-M01)

Discover more about diseases related to Serpin B3/SCCA1 Antibody (H00006317-M01).
 

Pathways for Serpin B3/SCCA1 Antibody (H00006317-M01)

View related products by pathway.

PTMs for Serpin B3/SCCA1 Antibody (H00006317-M01)

Learn more about PTMs related to Serpin B3/SCCA1 Antibody (H00006317-M01).
 

Research Areas for Serpin B3/SCCA1 Antibody (H00006317-M01)

Find related products by research area.

Blogs on Serpin B3/SCCA1

There are no specific blogs for Serpin B3/SCCA1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Serpin B3/SCCA1 Antibody (2F5) and receive a gift card or discount.

Bioinformatics

Gene Symbol SERPINB3
Entrez
OMIM
Uniprot