Recombinant Human SENP3 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human SENP3 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 301-400 of Human SENP3

Source: Wheat Germ

Amino Acid Sequence: EKAGQHSPLREEHVTCVQSILDEFLQTYGSLIPLSTDEVVEKLEDIFQQEFSTPSRKGLVLQLIQSYQRMPGNAMVRGFRVAYKRHVLTMDDLGTLYGQN

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
SENP3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SENP3 Protein

  • DKFZP586K0919
  • DKFZp762A152
  • EC 3.4.22
  • EC 3.4.22.-
  • sentrin/SUMO-specific protease 3
  • Sentrin/SUMO-specific protease SENP3
  • sentrin-specific protease 3
  • SMT3IP1
  • SSP3DKFZp586K0919
  • SUMO1/sentrin/SMT3 specific peptidase 3
  • SUMO1/sentrin/SMT3 specific protease 3
  • SUMO-1-specific protease 3
  • SUSP3

Background

SENP3 - SUMO1/sentrin/SMT3 specific protease 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-32901
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, PAGE
NB100-56444
Species: Hu, Mu
Applications: WB, IHC-P
NBP2-67842
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56405
Species: Hu, Mu
Applications: WB, Simple Western
NB110-61646
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-03852
Species: Hu, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-02623
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00026054-M01
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IHC-P
NB100-616
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, ICC/IF, IP, In vitro, Flow-IC
NB400-148
Species: Hu, Mu, Rt, Po, ChHa, Pm
Applications: WB, EM, ICC/IF, IHC, IHC-P
NBP2-37523
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
NB120-1868
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NB200-331
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP2-38160
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-38921
Species: Hu
Applications: IHC, IHC-P
NB120-2938
Species: Hu, Mu, Bv
Applications: WB, IHC, IHC-P
NBP1-51641
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, Flow-IC
H00026168-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for SENP3 Partial Recombinant Protein (H00026168-Q01) (0)

There are no publications for SENP3 Partial Recombinant Protein (H00026168-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SENP3 Partial Recombinant Protein (H00026168-Q01) (0)

There are no reviews for SENP3 Partial Recombinant Protein (H00026168-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SENP3 Partial Recombinant Protein (H00026168-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for SENP3 Partial Recombinant Protein (H00026168-Q01)

Discover related pathways, diseases and genes to SENP3 Partial Recombinant Protein (H00026168-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SENP3 Partial Recombinant Protein (H00026168-Q01)

Discover more about diseases related to SENP3 Partial Recombinant Protein (H00026168-Q01).
 

Pathways for SENP3 Partial Recombinant Protein (H00026168-Q01)

View related products by pathway.

PTMs for SENP3 Partial Recombinant Protein (H00026168-Q01)

Learn more about PTMs related to SENP3 Partial Recombinant Protein (H00026168-Q01).

Blogs on SENP3

There are no specific blogs for SENP3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

p19ARF Antibody
NB200-106
SENP3 Antibody
NBP1-56590

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SENP3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SENP3