Semaphorin 7A Antibody (1G1)

Images

 
Immunocytochemistry/ Immunofluorescence: Semaphorin 7A Antibody (1G1) [H00008482-M06] - Analysis of monoclonal antibody to SEMA7A on HeLa cell. Antibody concentration 10 ug/ml
Sandwich ELISA: Semaphorin 7A Antibody (1G1) [H00008482-M06] - Detection limit for recombinant GST tagged SEMA7A is 1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
1G1
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Semaphorin 7A Antibody (1G1) Summary

Immunogen
SEMA7A (NP_003603 536 a.a. - 633 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EPHKECPNPKPDKAPLQKVSLAPNSRYYLSCPMESRHATYSWRHKENVEQSCEPGHQSPNCILFIENLTAQQYGHYFCEAQEGSYFREAQHWQLLPED
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SEMA7A
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
It has been used for ELISA and WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Semaphorin 7A Antibody (1G1)

  • CD108 antigen
  • CD108
  • CD108MGC126696
  • CDw108
  • H-SEMA-K1
  • H-Sema-L
  • JMH blood group antigen
  • JMH
  • John-Milton-Hargen human blood group Ag
  • MGC126692
  • sema domain, immunoglobulin domain (Ig), and GPI membrane anchor, (semaphorin)7A (JMH blood group)
  • sema domain, immunoglobulin domain (Ig), and GPI membrane anchor, (semaphorin)7A
  • sema domain, immunoglobulin domain (Ig), and GPI membrane anchor, 7A
  • Sema K1
  • Sema L
  • Sema7A
  • SEMAK1
  • SEMAL
  • SEMALJohn Milton Hagen blood group H-Sema K1
  • Semaphorin 7A
  • semaphorin 7A, GPI membrane anchor (John Milton Hagen blood group)
  • semaphorin K1
  • semaphorin L
  • semaphorin-7A
  • semaphorin-K1
  • semaphorin-L

Background

SEMA7A is a membrane-bound semaphorin that associates with cell surfaces via a glycosylphosphatidylinositol (GPI) linkage. SEMA7A is also known as the John-Milton-Hagen (JMH) blood group antigen, an 80-kD glycoprotein expressed on activated lymphocytes and erythrocytes.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
AF2009
Species: Hu
Applications: WB, IHC
NBP2-24557
Species: Hu, Eq, Pm
Applications: WB, IHC-P
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
AF5375
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
NBP2-25198
Species: Hu
Applications: Flow, IP, Flow-CS
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
NBP2-36561
Species: Hu, Mu
Applications: WB, B/N, ELISA, Flow, ICC/IF, IHC-Fr, IP
AF3749
Species: Hu
Applications: WB, IHC
AF4309
Species: Hu, Mu
Applications: WB, IHC, ICC
NB500-330
Species: Hu
Applications: B/N, Flow, IHC, IHC-P, IP, CyTOF-ready
AF566
Species: Mu, Rt
Applications: WB, Flow, IHC, Block, CyTOF-ready
AF7895
Species: Hu
Applications: WB, IHC
AF4075
Species: Mu, Rt
Applications: WB, IHC
NB100-2218
Species: Hu, Mu, Rt, Bv, Ca, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00008482-M06
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for Semaphorin 7A Antibody (H00008482-M06) (0)

There are no publications for Semaphorin 7A Antibody (H00008482-M06).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Semaphorin 7A Antibody (H00008482-M06) (0)

There are no reviews for Semaphorin 7A Antibody (H00008482-M06). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Semaphorin 7A Antibody (H00008482-M06) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Semaphorin 7A Products

Bioinformatics Tool for Semaphorin 7A Antibody (H00008482-M06)

Discover related pathways, diseases and genes to Semaphorin 7A Antibody (H00008482-M06). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Semaphorin 7A Antibody (H00008482-M06)

Discover more about diseases related to Semaphorin 7A Antibody (H00008482-M06).
 

Pathways for Semaphorin 7A Antibody (H00008482-M06)

View related products by pathway.

PTMs for Semaphorin 7A Antibody (H00008482-M06)

Learn more about PTMs related to Semaphorin 7A Antibody (H00008482-M06).
 

Research Areas for Semaphorin 7A Antibody (H00008482-M06)

Find related products by research area.

Blogs on Semaphorin 7A

There are no specific blogs for Semaphorin 7A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Semaphorin 7A Antibody (1G1) and receive a gift card or discount.

Bioinformatics

Gene Symbol SEMA7A
Entrez
Uniprot