Semaphorin 4D/CD100 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

Semaphorin 4D/CD100 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SEMA4D.
  
  

  Source: E. coli

  Amino Acid Sequence: LLIGKKKPKSDFCDREQSLKETLVEPGSFSQQNGEHPKPALDTGYETEQDTITSKVPTDREDSQRIDDLSARDKPFDVKCELKFADSDADGD

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: SEMA4D
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86705.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 28 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Semaphorin 4D/CD100 Recombinant Protein Antigen

• A8
• BB18
• CD100 antigen
• CD100
• CD100M-sema-G
• COLL-4
• FLJ33485
• FLJ34282
• FLJ39737
• FLJ46484
• immunoglobulin domain (Ig), transmembrane domain (TM) and shortcytoplasmic domain, 4D
• MGC169138
• MGC169141
• M-sema-G
• sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and shortcytoplasmic domain, (semaphorin) 4D
• SEMA4D
• SEMAJ
• Semaphorin 4D
• semaphorin-4D

Background

Semaphorins are neuronal chemorepellants that direct pioneering neurons during nervous system development. CD100, a 150 kDa homodimer, is a novel semaphorin that induces B cells to aggregate and improves their viability in vitro. CD100 modifies CD40-CD40L B cell signaling by augmenting B cell aggregation and survival and down regulating CD23 expression. CD72 is a lymphocyte receptor for the class IV semaphorin CD100, which is involved in regulating B cell signaling. CD100 is expressed on resting and PHA stimulated T cells. The protein is weakly expressed on NK cells, EBV transformed B cells, monocytes and tumor/peripheral blood T cell lines, and at higher density on activated T cells and B cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: SEMA4D