CD72 Antibody - BSA Free

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: CD72 Antibody [NBP2-38533] - Analysis in human spleen and skeletal muscle tissues using NBP2-38533 antibody. Corresponding CD72 RNA-seq data are presented for ...read more
Immunocytochemistry/ Immunofluorescence: CD72 Antibody [NBP2-38533] - Staining of human cell line SH-SY5Y shows localization to nucleus & mitochondria.
Immunohistochemistry-Paraffin: CD72 Antibody [NBP2-38533] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: CD72 Antibody [NBP2-38533] - Staining of human spleen shows moderate membranous and cytoplasmic positivity in cells in white and red pulp.
Immunohistochemistry-Paraffin: CD72 Antibody [NBP2-38533] - Staining of human tonsil shows moderate membranous and cytoplasmic positivity in germinal and non-germinal center cells.
Immunohistochemistry-Paraffin: CD72 Antibody [NBP2-38533] - Staining of human kidney shows no positivity in cells in tubules as expected.
Immunohistochemistry-Paraffin: CD72 Antibody [NBP2-38533] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free
Validated by:
       

Orthogonal Strategies

 

Order Details

View Available Formulations
Catalog# & Formulation Size Price

CD72 Antibody - BSA Free Summary

Description
Novus Biologicals Rabbit CD72 Antibody - BSA Free (NBP2-38533) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: AQSQEALQVEQRAHQAAEGQLQACQADRQKTKETLQSEEQQRRALEQKLSNMENRLKPFFTCGSADTCCPSGWIMHQKSCFYISLTSKNWQESQKQCETLSSKLATFSEIYPQSHSYYFLNSLLPNGGSGNSYWTGLSSNKDWKLTD
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CD72
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CD72 Protein (NBP2-38533PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CD72 Antibody - BSA Free

  • CD72 antigenB-cell differentiation antigen CD72
  • CD72 molecule
  • CD72
  • CD72b
  • Ly-19.2
  • Ly-32.2
  • Lyb-2
  • LYB2lyb-2

Background

CD72 antigen is a member of the type II integral membrane glycoproteins which includes other related cell surface molecules such as the asialoglycoprotein receptors, CD23 and the Kupffer cell receptor. The function of CD72 is unknown but the exposure of B cells to CD72 antibodies activates a variety of signaling pathways and can induce MHC class II expression and B cell proliferation. CD72 antigen is expressed on all cells of B cell lineage with the exception of plasma cells and weakly on human tissue macrophages.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

7268-CT
Species: Hu
Applications: BA
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
NBP2-70360
Species: Hu
Applications: CyTOF-ready, Flow, IMC, ICC/IF, IHC,  IHC-P, WB
AF5235
Species: Mu
Applications: CyTOF-ready, Flow, IHC, WB
M4000B
Species: Mu
Applications: ELISA
1968-SL
Species: Hu
Applications: BA
AF5129
Species: Hu
Applications: WB
NBP2-25196
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, In vitro, WB
NBP1-83276
Species: Hu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF632
Species: Hu
Applications: AgAct, Simple Western, WB
AF123
Species: Hu
Applications: Block, ICC, WB
MAB602
Species: Hu, Pm
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), ICC
MAB140
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, IHC, Neut
AF3749
Species: Hu
Applications: IHC, WB
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NB600-1441
Species: Ca, Hu, Mu, Po
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, KD
NBP1-49045
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, InhibTFunc
AF114
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
NBP2-67605
Species: Hu, Pm, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, ISH, WB

Publications for CD72 Antibody (NBP2-38533) (0)

There are no publications for CD72 Antibody (NBP2-38533).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD72 Antibody (NBP2-38533) (0)

There are no reviews for CD72 Antibody (NBP2-38533). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for CD72 Antibody (NBP2-38533) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CD72 Products

Research Areas for CD72 Antibody (NBP2-38533)

Find related products by research area.

Blogs on CD72

There are no specific blogs for CD72, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CD72 Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol CD72
Uniprot