CD72 Antibody

Immunohistochemistry-Paraffin: CD72 Antibody [NBP2-38533] - Analysis in human spleen and skeletal muscle tissues using NBP2-38533 antibody. Corresponding CD72 RNA-seq data are presented for the same tissues.

Immunocytochemistry/Immunofluorescence: CD72 Antibody [NBP2-38533] - Staining of human cell line SH-SY5Y shows localization to nucleus & mitochondria.

Immunohistochemistry-Paraffin: CD72 Antibody [NBP2-38533] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Immunohistochemistry-Paraffin: CD72 Antibody [NBP2-38533] - Staining of human spleen shows moderate membranous and cytoplasmic positivity in cells in white and red pulp.

Immunohistochemistry-Paraffin: CD72 Antibody [NBP2-38533] - Staining of human tonsil shows moderate membranous and cytoplasmic positivity in germinal and non-germinal center cells.

Immunohistochemistry-Paraffin: CD72 Antibody [NBP2-38533] - Staining of human kidney shows no positivity in cells in tubules as expected.

Immunohistochemistry-Paraffin: CD72 Antibody [NBP2-38533] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.

• Reactivity: Hu
• Applications: ICC/IF, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

CD72 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: AQSQEALQVEQRAHQAAEGQLQACQADRQKTKETLQSEEQQRRALEQKLSNMENRLKPFFTCGSADTCCPSGWIMHQKSCFYISLTSKNWQESQKQCETLSSKLATFSEIYPQSHSYYFLNSLLPNGGSGNSYWTGLSSNKDWKLTD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CD72
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  CD72 Protein (NBP2-38533PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for CD72 Antibody

• CD72 antigenB-cell differentiation antigen CD72
• CD72 molecule
• CD72
• CD72b
• Ly-19.2
• Ly-32.2
• Lyb-2
• LYB2lyb-2

Background

CD72 antigen is a member of the type II integral membrane glycoproteins which includes other related cell surface molecules such as the asialoglycoprotein receptors, CD23 and the Kupffer cell receptor. The function of CD72 is unknown but the exposure of B cells to CD72 antibodies activates a variety of signaling pathways and can induce MHC class II expression and B cell proliferation. CD72 antigen is expressed on all cells of B cell lineage with the exception of plasma cells and weakly on human tissue macrophages.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CD72
• Uniprot:
  • P21854()