Semaphorin 4D/CD100 Antibody - BSA Free

Western Blot: Semaphorin 4D/CD100 Antibody [NBP1-86705] - Analysis in human cell line HDLM-2.

Immunohistochemistry-Paraffin: Semaphorin 4D/CD100 Antibody [NBP1-86705] - Staining of human cervix shows moderate granular cytoplasmic positivity in squamous epithelial cells.

Immunohistochemistry-Paraffin: Semaphorin 4D/CD100 Antibody [NBP1-86705] - Staining of human lymph node shows moderate membranous and cytoplasmic positivity in germinal and non-germinal center cells.

Immunohistochemistry-Paraffin: Semaphorin 4D/CD100 Antibody [NBP1-86705] - Staining of human colon shows strong membranous and ctyoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: Semaphorin 4D/CD100 Antibody [NBP1-86705] - Staining of human cerebral cortex shows moderate membranous and ctyoplasmic positivity in neuropil.

Analysis in human cell line HDLM-2.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Semaphorin 4D/CD100 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LLIGKKKPKSDFCDREQSLKETLVEPGSFSQQNGEHPKPALDTGYETEQDTITSKVPTDREDSQRIDDLSARDKPFDVKCELKFADSDADGD
• Predicted Species: Mouse (92%), Rat (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SEMA4D
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Semaphorin 4D/CD100 Protein (NBP1-86705PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Semaphorin 4D/CD100 Antibody - BSA Free

• A8
• BB18
• CD100 antigen
• CD100
• CD100M-sema-G
• COLL-4
• FLJ33485
• FLJ34282
• FLJ39737
• FLJ46484
• immunoglobulin domain (Ig), transmembrane domain (TM) and shortcytoplasmic domain, 4D
• MGC169138
• MGC169141
• M-sema-G
• sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and shortcytoplasmic domain, (semaphorin) 4D
• SEMA4D
• SEMAJ
• Semaphorin 4D
• semaphorin-4D

Background

Semaphorins are neuronal chemorepellants that direct pioneering neurons during nervous system development. CD100, a 150 kDa homodimer, is a novel semaphorin that induces B cells to aggregate and improves their viability in vitro. CD100 modifies CD40-CD40L B cell signaling by augmenting B cell aggregation and survival and down regulating CD23 expression. CD72 is a lymphocyte receptor for the class IV semaphorin CD100, which is involved in regulating B cell signaling. CD100 is expressed on resting and PHA stimulated T cells. The protein is weakly expressed on NK cells, EBV transformed B cells, monocytes and tumor/peripheral blood T cell lines, and at higher density on activated T cells and B cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SEMA4D