SEC61A Antibody - BSA Free

Western Blot: SEC61A Antibody [NBP2-86799] - Host: Rabbit. Target Name: SEC61A1. Sample Tissue: Human Hela Whole Cell. Antibody Dilution: 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

SEC61A Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SEC61A Antibody - BSA Free (NBP2-86799) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SEC61A. Peptide sequence: NLYVISQMLSARFSGNLLVSLLGTWSDTSSGGPARAYPVGGLCYYLSPPE The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SEC61A1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for SEC61A Antibody - BSA Free

• HSEC61
• protein transport protein SEC61 alpha subunit
• protein transport protein Sec61 subunit alpha isoform 1
• protein transport protein Sec61 subunit alpha
• Sec61 alpha 1 subunit (S. cerevisiae)
• Sec61 alpha-1
• sec61 homolog
• SEC61
• SEC61A

Background

SEC61A belongs to the SECY/SEC61 alpha family. It has similarity to a mouse protein which suggests a role in the insertion of secretory and membrane polypeptides into the endoplasmic reticulum.The SEC61 complex is responsible for translocation of proteins across the rough endoplasmic reticulum membrane. SEC61 is composed of three subunits: alpha, beta, and gamma; that associate to form a heterotrimer. Multiple heterotrimers associate forming the ER translocon. SEC61 alpha is a polytopic protein that has ten membrane-spanning loops. SEC61 has been found to be tightly associated with membrane bound ribosomes, either directly or through adaptor proteins, and is required for assembly of membrane and secretory proteins.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SEC61A1