SEC23IP Antibody

Images

 
Independent Antibodies: Western Blot: SEC23IP Antibody [NBP2-58361] - Analysis using Anti-SEC23IP antibody NBP2-58361 (A) shows similar pattern to independent antibody NBP1-82456 (B).
Immunocytochemistry/ Immunofluorescence: SEC23IP Antibody [NBP2-58361] - Staining of human cell line U-2 OS shows localization to vesicles.
Genetic Strategies: Western Blot: SEC23IP Antibody [NBP2-58361] - Analysis in A-549 cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented. Loading ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SEC23IP Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: CPGPLAVANGVVKQLHFQEKQMPEEPKLTLDESYDLVVENEEVLTLQETLEALSLSEYFSTFEKEKIDMESLLMCTVDDLKEM
Specificity
Specificity of human SEC23IP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SEC23IP
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Knockdown Validated
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for SEC23IP Antibody

  • P125
  • P125A
  • SEC23 interacting protein
  • SEC23-interacting protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67327
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-67427
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-67627
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
H00007837-Q01
Species: Hu
NBP1-88650
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-00532
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-67360
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB100-56583
Species: Hu, Rb
Applications: WB, Flow, IHC-P, KO
H00010714-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-01345
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
DDX0131P-100
Species: Hu
Applications: Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-90149
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-62664
Species: Hu
Applications: IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-85383
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84168
Species: Hu
Applications: IHC, IHC-P

Publications for SEC23IP Antibody (NBP2-58361) (0)

There are no publications for SEC23IP Antibody (NBP2-58361).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SEC23IP Antibody (NBP2-58361) (0)

There are no reviews for SEC23IP Antibody (NBP2-58361). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SEC23IP Antibody (NBP2-58361) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SEC23IP Products

Bioinformatics Tool for SEC23IP Antibody (NBP2-58361)

Discover related pathways, diseases and genes to SEC23IP Antibody (NBP2-58361). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SEC23IP Antibody (NBP2-58361)

Discover more about diseases related to SEC23IP Antibody (NBP2-58361).
 

Pathways for SEC23IP Antibody (NBP2-58361)

View related products by pathway.

Research Areas for SEC23IP Antibody (NBP2-58361)

Find related products by research area.

Blogs on SEC23IP

There are no specific blogs for SEC23IP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SEC23IP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SEC23IP