SCYL1 Antibody - BSA Free

Western Blot: SCYL1 Antibody [NBP2-88225] - WB Suggested Anti-SCYL1 Antibody. Titration: 1.0 ug/ml. Positive Control: Fetal Brain

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

SCYL1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SCYL1 Antibody - BSA Free (NBP2-88225) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of SCYL1. Peptide sequence: FATLSARPSTQPRPDSWGEDNWEGLETDSRQVKAELARKKREERRREMEA The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SCYL1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for SCYL1 Antibody - BSA Free

• Coated vesicle-associated kinase of 90 kDa
• CVAK90
• GKLPTelomerase transcriptional element-interacting factor
• likely ortholog of mouse N-terminal kinase-like protein
• MGC78454
• NKTL
• N-terminal kinase-like protein
• NTKLN-terminal kinase-like
• P105
• SCY1-like 1 (S. cerevisiae)
• TAPKTeratoma-associated tyrosine kinase
• TEIFSCY1-like protein 1
• Telomerase regulation-associated protein
• telomerase transcriptional elements-interacting factor
• TRAPHT019

Background

SCYL1 encodes a transcriptional regulator belonging to the SCY1-like family of kinase-like proteins. The protein has a divergent N-terminal kinase domain that is thought to be catalytically inactive, and can bind specific DNA sequences through its C-terminal domain. It activates transcription of the telomerase reverse transcriptase and DNA polymerase beta genes. The protein has been localized to the nucleus, and also to the cytoplasm and centrosomes during mitosis. Multiple transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SCYL1