SCUBE1 Antibody

Images

 
Immunohistochemistry-Paraffin: SCUBE1 Antibody [NBP1-86522] - Staining of human ovary shows moderate cytoplasmic positivity in ovarian stroma cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SCUBE1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EVSHITAEFEIETKMEEASDTCEADCLRKRAEQSLQAAIKTLRKSIGRQQFYVQVSGTEYEVAQRPAKALEGQGACGAGQVLQDSKCVACGPGTHFGGELGQCVPCMPGTYQDMEGQLSCTPCPSSDGLGLPGARNVSECGGKC
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SCUBE1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SCUBE1 Protein (NBP1-86522PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (82%), Rat (83%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SCUBE1 Antibody

  • signal peptide, CUB and EGF-like domain-containing protein 1
  • signal peptide, CUB domain, EGF-like 1
  • signal peptide-CUB domain-EGF-related 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-77186
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IF
AF1927
Species: Hu
Applications: WB, IP, ICC
NBP2-01625
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB600-600
Species: Hu, Mu
Applications: WB, ChIP, ELISA, IHC, IHC-P, Flow-IC
NBP1-57016
Species: Hu
Applications: WB
H00003077-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85594
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB500-519
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IP
NBP2-23602
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NB200-118
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-22617
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NB110-53818
Species: Hu, Mu, Rt, Po, Bv, Pm, Xp, Ze
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, PLA
NB500-525
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
AF8005
Species: Hu
Applications: WB
NBP2-42213
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
NBP1-86522
Species: Hu
Applications: IHC, IHC-P

Publications for SCUBE1 Antibody (NBP1-86522) (0)

There are no publications for SCUBE1 Antibody (NBP1-86522).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SCUBE1 Antibody (NBP1-86522) (0)

There are no reviews for SCUBE1 Antibody (NBP1-86522). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SCUBE1 Antibody (NBP1-86522) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SCUBE1 Products

Bioinformatics Tool for SCUBE1 Antibody (NBP1-86522)

Discover related pathways, diseases and genes to SCUBE1 Antibody (NBP1-86522). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SCUBE1 Antibody (NBP1-86522)

Discover more about diseases related to SCUBE1 Antibody (NBP1-86522).
 

Pathways for SCUBE1 Antibody (NBP1-86522)

View related products by pathway.

PTMs for SCUBE1 Antibody (NBP1-86522)

Learn more about PTMs related to SCUBE1 Antibody (NBP1-86522).

Blogs on SCUBE1

There are no specific blogs for SCUBE1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SCUBE1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SCUBE1