SCD5 Antibody - BSA Free

Western Blot: SCD5 Antibody [NBP2-83499] - Host: Rabbit. Target Name: SCD5. Sample Type: HT1080 Whole Cell lysates. Antibody Dilution: 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

SCD5 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SCD5 Antibody - BSA Free (NBP2-83499) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human SCD5. Peptide sequence: HRAHHKYSETDADPHNARRGFFFSHIGWLFVRKHRDVIEKGRKLDVTDLL The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SCD5
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for SCD5 Antibody - BSA Free

• ACOD4
• ACOD4Acyl-CoA-desaturase 4
• FADS4
• FLJ21032
• HSCD5
• HSCD5Stearoyl-CoA 9-desaturase
• SCD2
• SCD4
• SCD4EC 1.14.19.1
• SCD5
• stearoyl-CoA desaturase 4
• stearoyl-CoA desaturase 5

Background

Stearoyl-CoA desaturase (SCD; EC 1.14.99.5) is an integral membrane protein of the endoplasmic reticulum that catalyzesthe formation of monounsaturated fatty acids from saturated fatty acids. SCD may be a key regulator of energymetabolism with a role in obesity and dislipidemia. Four SCD isoforms, Scd1 through Scd4, have been identified inmouse. In contrast, only 2 SCD isoforms, SCD1 (MIM 604031) and SCD5, have been identified in human. SCD1 shares about85% amino acid identity with all 4 mouse SCD isoforms, as well as with rat Scd1 and Scd2. In contrast, SCD5 shareslimited homology with the rodent SCDs and appears to be unique to primates (Wang et al., 2005 (PubMed15907797)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SCD5