SCD-1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SCD-1 Antibody [NBP1-84749] - Immunofluorescent staining of human cell line A-431 shows localization to endoplasmic reticulum.
Immunohistochemistry-Paraffin: SCD-1 Antibody [NBP1-84749] - Staining of human liver shows strong cytoplasmic positivity in bile ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SCD-1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ISSSYTTTTTITAPPSRVLQNGGDKLETMPLYLEDDIRPDIKDDIYDPTYKDKEGPSPKVEY
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SCD
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SCD-1 Recombinant Protein Antigen (NBP1-84749PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SCD-1 Antibody

  • FADS5
  • MSTP008
  • SCD1
  • SCD-1
  • SCDOS
  • Stearoyl-CoA desaturase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB400-114
Species: Hu, Mu, Rt, Po, Ch, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB600-582
Species: Hu, Mu, Rt, Ca, Ch, SyHa, Ha
Applications: WB, Simple Western
45800002
Species: Hu
Applications: WB, ELISA
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-84312
Species: Hu
Applications: WB, IHC, IHC-P
AF6898
Species: Hu, Mu, Rt
Applications: WB
NBP1-84311
Species: Hu
Applications: IHC, IHC-P
NB120-13550
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2564
Species: Hu
Applications: WB
NBP2-01743
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-78039
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-CS
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
AF7197
Species: Hu, Mu
Applications: WB, IHC, ICC

Publications for SCD-1 Antibody (NBP1-84749) (0)

There are no publications for SCD-1 Antibody (NBP1-84749).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SCD-1 Antibody (NBP1-84749) (0)

There are no reviews for SCD-1 Antibody (NBP1-84749). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SCD-1 Antibody (NBP1-84749) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SCD-1 Products

Bioinformatics Tool for SCD-1 Antibody (NBP1-84749)

Discover related pathways, diseases and genes to SCD-1 Antibody (NBP1-84749). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SCD-1 Antibody (NBP1-84749)

Discover more about diseases related to SCD-1 Antibody (NBP1-84749).
 

Pathways for SCD-1 Antibody (NBP1-84749)

View related products by pathway.

PTMs for SCD-1 Antibody (NBP1-84749)

Learn more about PTMs related to SCD-1 Antibody (NBP1-84749).

Blogs on SCD-1

There are no specific blogs for SCD-1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SCD-1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SCD
Entrez