SCAMP1 Antibody - BSA Free Summary
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human SCAMP1 (NP_004857.4). MSDFDSNPFADPDLNNPFKDPSVTQVTRNVPPGLDEYNPFSDSRTPPPGGVKMPNVPNTQPAIMKPTEEHPAYTQIAKEHALAQAELLKRQEELERKAAELDRREREMQNLSQHGRKNNWPPLPSNFPVGPCFYQDFSVDIPVEFQKTVK |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
SCAMP1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Western Blot 1:500-1:2000
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for SCAMP1 Antibody - BSA Free
Background
SCAMP1 (Secretory Carrier Membrane Protein 1) belongs to the SCAMP family of proteins which are secretory carrier membrane proteins functioning as carriers to the cell surface in post-golgi recycling pathways. Different family members are highly related products of distinct genes, and are usually expressed together. These findings suggest that the SCAMPs may function at the same site during vesicular transport rather than in separate pathways.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: WB
Species: Ch, Fe, Hu, Pm, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Ca, Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
Species: Hu
Applications: ICC, WB
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
Species: Hu, Mu, Pl, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: BA
Species: Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Publications for SCAMP1 Antibody (NBP2-93055) (0)
There are no publications for SCAMP1 Antibody (NBP2-93055).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for SCAMP1 Antibody (NBP2-93055) (0)
There are no reviews for SCAMP1 Antibody (NBP2-93055).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for SCAMP1 Antibody (NBP2-93055) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional SCAMP1 Products
Research Areas for SCAMP1 Antibody (NBP2-93055)
Find related products by research area.
|
Blogs on SCAMP1