SCAMP5 Antibody - BSA Free

Western Blot: SCAMP5 Antibody [NBP2-13284] - Analysis in control (vector only transfected HEK293T lysate) and SCAMP5 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: SCAMP5 Antibody [NBP2-13284] - Staining of human skin shows no positivity in squamous epithelial cells as expected.

Immunohistochemistry-Paraffin: SCAMP5 Antibody [NBP2-13284] - Staining of human cerebral cortex shows high expression.

Immunohistochemistry-Paraffin: SCAMP5 Antibody [NBP2-13284] - Staining of human liver shows low expression as expected.

Immunohistochemistry-Paraffin: SCAMP5 Antibody [NBP2-13284] - Analysis in human cerebral cortex and liver tissues using NBP2-13284 antibody. Corresponding SCAMP5 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: SCAMP5 Antibody [NBP2-13284] - Staining of human cerebral cortex shows strong positivity in neuropil.

Immunohistochemistry-Paraffin: SCAMP5 Antibody [NBP2-13284] - Staining of human cerebellum shows strong granular cytoplasmic positivity in Purkinje cells and cells in granular layer.

Immunohistochemistry-Paraffin: SCAMP5 Antibody [NBP2-13284] - Staining of human liver shows no positivity in hepatocytes as expected.

Staining of human liver shows no positivity in hepatocytes as expected.

Analysis in control (vector only transfected HEK293T lysate) and SCAMP5 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SCAMP5 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SCAMP5 Antibody - BSA Free (NBP2-13284) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: GSFSKAQEEWTTGAWKNPHVQQAAQNAAMGAAQGAMNQPQTQYSATPNYTYSNE
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SCAMP5
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  SCAMP5 Protein (NBP2-13284PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SCAMP5 Antibody - BSA Free

• DKFZp686L1799
• hSCAMP5
• MGC24969
• Sc5
• secretory carrier membrane protein 5
• secretory carrier-associated membrane protein 5

Background

Secretory Carrier Membrane Proteins (SCAMPs) are proteins that are components of post Golgi membranes. These proteins are implicated to function in membrane trafficking. In fibroblasts, SCAMPs are concentrated in compartments that are involved in the recycling of cell surface receptors and endocytosis. In neurons, SCAMPs are associated with synaptic vesicles, secretion granules and transporter vesicles. SCAMPs are composed of four central transmembrane regions and a cytoplasmic tail. Of the five known SCAMPs, SCAMPs 1-3 contain cytoplasmic N-terminal regions with NPF repeats. NPF repeats are found to interact with EH domain proteins that function in budding of transport vesicles from the plasma membrane or the Golgi complex. SCAMPs 4 and 5 lack the N-terminal NPF repeats. SCAMPs 1-4 are all ubiquitously coexpressed while SCAMP 5 is only detectable in the brain. Studies show that SCAMP 5 is expressed late in development which is coincident with expansion of mature synapses.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SCAMP5