SCAMP5 Antibody


Western Blot: SCAMP5 Antibody [NBP2-13284] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed more
Immunohistochemistry-Paraffin: SCAMP5 Antibody [NBP2-13284] - Staining of human liver shows low expression as expected.
Immunohistochemistry-Paraffin: SCAMP5 Antibody [NBP2-13284] - Staining of human cerebral cortex shows high expression.
Orthogonal Strategies: Immunohistochemistry-Paraffin: SCAMP5 Antibody [NBP2-13284] - Staining in human cerebral cortex and liver tissues using anti-SCAMP5 antibody. Corresponding SCAMP5 RNA-seq data are presented more

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Validated by:

Orthogonal Strategies


Order Details

SCAMP5 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: GSFSKAQEEWTTGAWKNPHVQQAAQNAAMGAAQGAMNQPQTQYSATPNYT YSNE
Specificity of human SCAMP5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SCAMP5 Protein (NBP2-13284PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for SCAMP5 Antibody

  • DKFZp686L1799
  • hSCAMP5
  • MGC24969
  • Sc5
  • secretory carrier membrane protein 5
  • secretory carrier-associated membrane protein 5


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Species: Hu
Applications: WB, IHC
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, ICC
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for SCAMP5 Antibody (NBP2-13284) (0)

There are no publications for SCAMP5 Antibody (NBP2-13284).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SCAMP5 Antibody (NBP2-13284) (0)

There are no reviews for SCAMP5 Antibody (NBP2-13284). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SCAMP5 Antibody (NBP2-13284) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional SCAMP5 Products

Bioinformatics Tool for SCAMP5 Antibody (NBP2-13284)

Discover related pathways, diseases and genes to SCAMP5 Antibody (NBP2-13284). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SCAMP5 Antibody (NBP2-13284)

Discover more about diseases related to SCAMP5 Antibody (NBP2-13284).

Pathways for SCAMP5 Antibody (NBP2-13284)

View related products by pathway.

Research Areas for SCAMP5 Antibody (NBP2-13284)

Find related products by research area.

Blogs on SCAMP5

There are no specific blogs for SCAMP5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SCAMP5 Antibody and receive a gift card or discount.


Gene Symbol SCAMP5