SCAMP5 Antibody

Images

 
Western Blot: SCAMP5 Antibody [NBP2-13284] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more
Immunohistochemistry-Paraffin: SCAMP5 Antibody [NBP2-13284] - Staining of human cerebellum shows distinct cytoplasmic positivity in Purkinje cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SCAMP5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GSFSKAQEEWTTGAWKNPHVQQAAQNAAMGAAQGAMNQPQTQYSATPNYT YSNE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SCAMP5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SCAMP5 Protein (NBP2-13284PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SCAMP5 Antibody

  • DKFZp686L1799
  • hSCAMP5
  • MGC24969
  • Sc5
  • secretory carrier membrane protein 5
  • secretory carrier-associated membrane protein 5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-79765
Species: Mu
Applications: WB
NBP2-45688
Species: Hu
Applications: WB, IHC
NBP2-53420
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90175
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-41263
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IF
NBP2-13347
Species: Hu
Applications: WB, IHC, IHC-P
AF5664
Species: Hu
Applications: WB, IHC, ICC
NB100-56703
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
NBP1-90003
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85574
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13792
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49320
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00006532-M06
Species: Hu
Applications: ELISA, IP
NBP1-80996
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for SCAMP5 Antibody (NBP2-13284) (0)

There are no publications for SCAMP5 Antibody (NBP2-13284).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SCAMP5 Antibody (NBP2-13284) (0)

There are no reviews for SCAMP5 Antibody (NBP2-13284). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SCAMP5 Antibody (NBP2-13284) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SCAMP5 Products

Bioinformatics Tool for SCAMP5 Antibody (NBP2-13284)

Discover related pathways, diseases and genes to SCAMP5 Antibody (NBP2-13284). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SCAMP5 Antibody (NBP2-13284)

Discover more about diseases related to SCAMP5 Antibody (NBP2-13284).
 

Pathways for SCAMP5 Antibody (NBP2-13284)

View related products by pathway.

Research Areas for SCAMP5 Antibody (NBP2-13284)

Find related products by research area.

Blogs on SCAMP5

There are no specific blogs for SCAMP5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SCAMP5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SCAMP5