SC4MOL Antibody

Images

 
Western Blot: SC4MOL Antibody [NBP2-85689] - Host: Rabbit. Target Name: SC4MOL. Sample Tissue: Human A172 Whole Cell lysates. Antibody Dilution: 1ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SC4MOL Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of human SC4MOL. Peptide sequence: FSSASLAVEYVDSLLPENPLQEPFKNAWNYMLNNYTKFQIATWGSLIVHE The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
MSMO1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SC4MOL Antibody

  • C-4 methyl sterol
  • C-4 methylsterol oxidase
  • EC 1.14.13.72
  • ERG25DESP4Methylsterol monooxygenase
  • MGC104344
  • sterol-C4-methyl oxidase-like

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-03109
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-32005
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-17029
Species: Hu, Mu, Rt
Applications: WB
NBP2-55973
Species: Hu
Applications: WB, ICC/IF
NBP2-84125
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-55775
Species: Hu
Applications: WB, ICC/IF
NBP1-89560
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-48733
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NLS2666
Species: Hu, Mu, Rt, Po, Bt, Bv, Ca, Eq, Ha, Pm, Rb
Applications: ICC/IF, IHC, IHC-P
NBP2-60655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP2-10509
Species: Hu, Mu(-)
Applications: WB, ELISA, IHC, IHC-P, IP
NBP2-57758
Species: Hu
Applications: ICC/IF
AF1180
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NBP2-49284
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92011
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB400-105
Species: Hu, Mu, Rt, Po, Ca, Ch, ChHa, Eq, Ha, Md, Pm, Rb
Applications: WB, ChIP, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N, Dual ISH-IHC, GS, KD, KO, PCR
NBP2-47415
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for SC4MOL Antibody (NBP2-85689) (0)

There are no publications for SC4MOL Antibody (NBP2-85689).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SC4MOL Antibody (NBP2-85689) (0)

There are no reviews for SC4MOL Antibody (NBP2-85689). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SC4MOL Antibody (NBP2-85689) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SC4MOL Products

Bioinformatics Tool for SC4MOL Antibody (NBP2-85689)

Discover related pathways, diseases and genes to SC4MOL Antibody (NBP2-85689). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on SC4MOL

There are no specific blogs for SC4MOL, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SC4MOL Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MSMO1